KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2527Help
Entry
SHJG_2527         CDS       T02063                                 

Definition
(GenBank) ROK-family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00052  Galactose metabolism
shy00500  Starch and sucrose metabolism
shy00520  Amino sugar and nucleotide sugar metabolism
shy00521  Streptomycin biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_2527
   00052 Galactose metabolism
    SHJG_2527
   00500 Starch and sucrose metabolism
    SHJG_2527
   00520 Amino sugar and nucleotide sugar metabolism
    SHJG_2527
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SHJG_2527
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SHJG_2527
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SHJG_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEY87802
UniProt: H2K1C9
Position
complement(3032435..3033388)
Genome map
AA seq 317 aa AA seqDB search
MHTDLVAALDIGGTKIAGALVDGGGRILARAQRATPAQQDGETVMRAVTEVLGDLAGSPL
WGRAASVGIGSAGPVDASAGTVSPVNVPGWRDFPLVDRVRTVTGGLPVELIGDGVAITAA
EHWQGAARGHDNALCMVVSTGVGGGLVLGGRLHPGPTGNAGHIGHISVDLDGDPCPCGSR
GCVERIASGPNIARRALEHGWRPGPDGDTSAAAVAAAARAGDPVAVASFERAAQALAAGI
AATATLVEIDIAVVGGGVGKAGDVLFTPLRKALTDYATLSFVRHLTVVPAQMGTDAGLVG
AAAAALTRAPDATAASR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgacctcgtggcggccctggacatcggcggcaccaagatcgccggcgcgctg
gtggacggcggcggccggatcctggcccgggcccagcgcgccacgcccgcccagcaggac
ggcgaaacggtcatgcgggccgtgacggaggtgctcggcgacctcgccgggtcgcccctg
tggggacgcgcggcctcggtcggcatcggcagcgccgggcccgtcgacgcctccgcgggc
accgtgagcccggtcaacgtgccgggctggcgcgacttcccactggtggaccgggtgcgt
acggtcaccgggggcctgccggtggagctgatcggcgacggtgtcgcgatcaccgcggcc
gagcactggcagggcgccgcgcgcggccacgacaacgcgctgtgcatggtggtctccacg
ggcgtcggcggcggcctggtgctgggcggacgcctgcatcccggtccgaccggcaacgcc
gggcacatcggccacatcagcgtcgacctggacggcgatccctgcccgtgcggctcgcgc
ggctgcgtggagcggatcgccagcggcccgaacatcgcccgccgggccctggaacacggc
tggcgccccgggcccgacggtgacacctcggccgccgcggtggccgccgccgcccgcgcg
ggcgaccccgtggccgtggcctccttcgagcgggccgcgcaggcgctcgccgccggtatc
gcggccaccgcgaccctggtcgagatcgacatcgcggtggtcggcgggggcgtcggcaag
gcgggcgacgtcctgttcacgcccctgcgcaaggccctcaccgactacgcgaccctgtcc
ttcgtgcggcacctcaccgtcgtgcccgcgcagatgggcaccgacgcgggcctggtcggc
gcggctgcggcggccctgacccgcgccccggacgcgacggcggcgagccgctag

DBGET integrated database retrieval system