KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2619Help
Entry
SHJG_2619         CDS       T02063                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SHJG_2619
   00051 Fructose and mannose metabolism
    SHJG_2619
Enzymes [BR:shy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SHJG_2619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3131698..3132864)
Genome map
AA seq 388 aa AA seqDB search
MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVETVQRLAELGAHGVTFHDDDLIP
FGSSDTERESHIKRFRQALDATGMTVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTI
RNIDLAAELGAKTYVAWGGREGAESGAAKDVRSALDRMKEAFDLLGEYVTSQGYDLRFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQSGIKYDQDLRFGAGDLRSAFWLVDLLESAGYEGPRHFDFKPPRTEDLDGVW
ASAAGCMRNYLILKERAAAFRADPEVQEALRASRLDQLAQPTAADGLEDLLADRAAFEDF
DVEAAAARGMAFERLDQLAMDHLLGARG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcccacccccgaggacaggttcacgttcggactctggaccgtcggctgg
cagggaagggacccgttcggcgacgccacccgccgcgccctcgacccggtcgagacggtg
cagcgcctggcggaactcggtgcccacggagtgaccttccacgacgacgacctgatcccc
ttcggttcgtcggacaccgagcgcgagtcgcacatcaagcggttccgccaggccctggac
gccaccggcatgaccgtcccgatggccaccacgaacctcttcacgcaccccgtcttcaag
gacggcgcgttcaccgccaacgaccgcgacgtgcgccgctacgccctccgcaagacgatc
cgcaacatcgacctggcggccgagctgggcgcgaagacgtacgtcgcctggggtggccgc
gagggcgccgagtccggcgccgccaaggacgtgcgttccgccctggaccgcatgaaggag
gccttcgacctcctcggcgagtacgtcacctcgcagggctacgacctccgcttcgccatc
gagcccaagccgaacgagccccgcggcgacatcctgctgcccaccgtcgggcacgcgctg
gccttcatcgagcgcctggagcggcccgagctctacggcgtcaaccccgaggtcggccac
gagcagatggccggcctgaacttcccgcacggcatcgcgcaggccctgtgggccgggaag
ctcttccacatcgacctcaacggccagtccggcatcaagtacgaccaggacctgcggttc
ggcgcgggcgacctgcggtccgccttctggctggtcgacctcctggagagcgccggttac
gaaggaccgcgccacttcgacttcaagccgccgcggaccgaggacctcgacggcgtgtgg
gcctcggcggcgggctgcatgcgcaactacctcatcctgaaggagcgcgcggcagccttc
cgcgccgaccccgaggtgcaggaggcgctgcgcgcctcgcgcctggaccagctggcccag
ccgaccgcggccgacggcctggaggacctgctcgccgaccgcgcggccttcgaggacttc
gacgtggaggccgccgccgcgcgcggcatggccttcgaacgcctcgaccagctggcgatg
gaccacctgctgggcgcgcggggctga

DBGET integrated database retrieval system