KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2653Help
Entry
SHJG_2653         CDS       T02063                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_2653
   01230 Biosynthesis of amino acids
    SHJG_2653
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_2653
   00030 Pentose phosphate pathway
    SHJG_2653
   00051 Fructose and mannose metabolism
    SHJG_2653
   00052 Galactose metabolism
    SHJG_2653
  Energy metabolism
   00680 Methane metabolism
    SHJG_2653
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SHJG_2653
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SHJG_2653
Protein phosphatases and associated proteins [BR:shy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SHJG_2653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3166492..3167517
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVADHGDEVIGFRDGWKGLLECDYLKLDLDAVGGI
LARGGTILGSSRVRPEHLRDGVERAKGHVAELGLDAIIPIGGEGTLKAARLLSDGGLPIV
GVPKTIDNDIAVTDVTFGFDTAVTVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAVVVPERPFDIDELTKKVGERFEAGKRFAIVVAAEGAKPRPGSMEFDEGGKDI
YGHERFAGIARQLSVELEQRLGKEARPVILGHVQRGGTPTPYDRVLATRFGWHAVEAVHR
GEFGMMTALRGTDIVMVSLAEAVETLKTVPAERYDEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtgtcctcacgtccggcggcgactgccccggcctgaacgccgtcatccgg
tccgtcgtgcaccgtgccgtcgccgaccacggcgacgaggtcatcggtttccgggacggc
tggaagggcctcctggaatgcgactacctgaaactcgacctggacgccgtgggcggcatc
ctcgcgcgcggcggcaccatcctcggctcctcccgggtccgcccggagcatctgcgggac
ggtgtggagcgggccaagggccatgtcgcggaactcggcctggacgcgatcatcccgatc
ggcggtgagggcacgctgaaggcggcccggctgctgtcggacggcgggctgccgatcgtg
ggcgtgcccaagaccatcgacaacgacatcgccgtcaccgatgtcaccttcggtttcgac
acggcggtgaccgtggcgaccgaggccctggaccggctgaagaccaccgccgagtcccac
cagcgcgtgctgatcgtggaggtcatgggccggcacaccggctggatcgcgctgcactcc
ggcatggcggccggcgcccacgccgtggtcgtgcccgagcggcccttcgacatcgacgag
ttgacgaagaaggtcggcgagcggttcgaggcgggcaagcggttcgccatagtggtcgcc
gccgagggggccaagccgcggcccggctccatggagttcgacgagggcggcaaggacatc
tacggccacgagcgcttcgcgggcatcgcgcggcagctgtcggtcgagctggagcagcgg
ctcggcaaggaggcccggccggtgatcctcgggcatgtgcagcggggcggcacgccgacg
ccgtacgaccgggtgctggcgacccgcttcggctggcacgcggtcgaggccgtgcaccgg
ggtgagttcggcatgatgacggcgctgcgcgggaccgacatcgtcatggtgtcgctggcg
gaggccgtggagacgctgaagaccgtaccggcggagcggtacgacgaggcggagtgcgtt
ctgtag

DBGET integrated database retrieval system