KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2705Help
Entry
SHJG_2705         CDS       T02063                                 

Definition
secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:shy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:shy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3211732..3213318
Genome map
AA seq 528 aa AA seqDB search
MSHRPLPGRRSVLRGSLAASAALTLPVGLGAAPAFARSGRPAAGWGVQTGDVTADSGLVW
VRSDRPARMIVETSATESFRNPRRWHGPLLGTGTDFTGTTRLHGLPSGEQIHYRVLLADP
DDPRRTGEPVTGTFRTVSRRRRDGVRFLWSGDLAGQGWGINPDLGGYRIYDAMAKLDPDF
FLCSGDNIYADGPITATQALPDGSTWRNITTEEKSKVAETLAEYRGNFRYNLLDANLRRF
NAQVPSIIQWDDHEVRNNWYPGEVIASTDTRYTEKSIDVLAARARRAFSEYFPLSTLRLG
AKEGRVYRVLRQGPLLDVFVLDMRTYRNANSPDDQTVDPQGILGREQLEWLKRELARSRA
VWKVIAADMPLGLVVPDPVENKPNFEAVAQGDPGAPLGRELQIAELLRFIKHRRITGTLW
LTADVHHTSAQHYQPSRAAFTDFEPFWEFVSGPLNAGAFSASALDGTFGPERVFVKAPTA
SNVSPAGGYQFFGEVDIDGDSGELTVRLREQDGTVLFAQTLQPGRVGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccgtccgctccccggtcgccgcagcgttctgcgcggctccctcgccgcgtcg
gcggccctgaccctgcccgtgggcctcggcgcggccccggcgttcgcccgctccggacgg
cccgcggccggctggggcgtgcagaccggtgacgtgaccgccgactccggtctggtgtgg
gtgcgttcggaccggcccgcccggatgatcgtggagacctcggccaccgagtcgttccgc
aacccccgcaggtggcacggtccgctgctgggcaccggcacggacttcaccggcaccacc
cggctgcacggcctgccctccggcgagcagatccactaccgggtgctgctcgccgacccg
gacgacccgcgccgcaccggcgagcccgtgaccggcaccttccgcacggtctcccggcgc
cgccgggacggcgtgcggttcctgtggtcgggcgacctggccggccagggctggggcatc
aaccccgacctcggcggctaccgcatctacgacgcgatggcgaagctggacccggacttc
ttcctgtgcagcggcgacaacatctacgccgacggccccatcaccgccacccaggcgctg
cccgacggcagcacctggcggaacatcaccaccgaggagaagtccaaggtcgccgagacc
ctcgccgagtaccggggcaacttccgctacaacctgctcgacgccaacctgcgccggttc
aacgcccaggtgccgtcgatcatccagtgggacgaccacgaggtgcgcaacaactggtac
ccgggcgaggtgatcgcctccacggacacccgctataccgagaagagcatcgacgtcctc
gccgcgcgggcccggcgggcgttcagcgagtacttccccctctccacgctgcgcctcggt
gccaaggagggccgcgtttaccgggtgctgcgccagggcccgctgctggacgtgttcgtg
ctcgacatgcggacctaccgcaacgccaactcccccgacgaccagaccgtggacccgcag
ggcatcctcggccgggagcagctggagtggctcaagcgggagctggcccggtcgcgcgcg
gtgtggaaggtgatcgccgccgacatgccgctcggcctggtcgtccccgacccggtggag
aacaagccgaacttcgaggcggtggcgcagggcgacccgggcgccccgctcggccgtgag
ttgcagatcgccgagttgctgcggttcatcaagcaccggcggatcaccgggacgctgtgg
ctgacggcggacgtgcaccacacctccgcccagcactaccagccgtcacgggccgcgttc
accgacttcgagccgttctgggagttcgtctcgggaccgctgaacgccggcgcgttctcg
gccagcgcgctggacggcacgttcggcccggagcgggtgttcgtgaaggcgccgaccgcg
tcgaacgtctcgcccgcgggcggctaccagttcttcggcgaggtcgacatcgacggggac
agcggcgagctgacggtacggctgcgcgagcaggacggcaccgtgctgttcgcacagacg
ctccagccgggccgggtcggccagtag

DBGET integrated database retrieval system