KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2904Help
Entry
SHJG_2904         CDS       T02063                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SHJG_2904
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SHJG_2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3438347..3438904)
Genome map
AA seq 185 aa AA seqDB search
MSERPRLTVLSGPSGVGKSTVVAHMRKEHPEVWLSVSATTRKPRPGEQHGVHYFFVTDEE
MDKLIANGELLEWAEFAGNRYGTPRAAVLERLENGEPVLLEIDLQGARQVRESMADAQLV
FLAPPSWEELVRRLTGRGTEPPEVIDRRLAAAKTELAAEPEFDTTLVNTSVEDVARELLA
LMDVV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacgtccgcggctgaccgtgctctccggcccctcgggggtcggcaagagcacg
gtcgtcgcccatatgcgcaaggaacaccccgaggtctggctgtcggtctcggcgacgacc
cgcaagccgcgccccggcgagcagcacggagtccactacttcttcgtcaccgacgaggag
atggacaagctgatcgccaacggcgaactgctggagtgggccgagttcgccggcaaccgc
tacggcaccccccgcgcggcggtgctggagcggctggagaacggcgagcccgtcctgctg
gagatcgacctccagggcgcccggcaggtccgcgagtccatggccgacgcccagctggtg
ttcctcgctccgccctcctgggaggagctggtgcgcaggctgaccggccgggggaccgag
ccgcccgaggtcatcgaccgccgcctggcggcggcgaagaccgagctggcggccgagccg
gagttcgatacgaccttggtcaacacctccgtcgaggacgtggcccgcgagctgctagcc
ttgatggacgttgtgtga

DBGET integrated database retrieval system