KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_2943Help
Entry
SHJG_2943         CDS       T02063                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SHJG_2943
Enzymes [BR:shy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SHJG_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3481552..3482157)
Genome map
AA seq 201 aa AA seqDB search
MIAFVSGTVAALAPDAAVVEVGGVGMAVQCTPNTLSTLRIGRPARLHTSLVVREDSLTLY
GFADDDERQVFELLQTASGVGPRLAQAMLAVHTPDALRRAVATGDEKALTAVPGIGKKGA
QKLLLELKDRLGAPVGAPAVGTPVSQGWRDQLHAALIGLGYATREADEAVAAVAPQAEAA
GGTPQVGQLLKAALQTLNRAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccttcgtcagcggcacggtcgccgcgctcgcccccgacgccgcggtcgtcgag
gtcggcggcgtcggcatggccgtccagtgcaccccgaacacgctgtcgaccctgcggatc
ggccggccggccaggctgcacacctccctcgtcgtccgcgaggactcgctcaccctgtac
ggcttcgccgacgacgacgagcgccaggtcttcgaactgctccagaccgcgagcggcgtc
ggcccgcgcctggcccaggcgatgctcgccgtgcacaccccggacgcgctgcgccgcgcg
gtcgccaccggtgacgagaaggccctgaccgccgtccccggcatcggcaagaagggcgcc
cagaagctgctgctggagctgaaggaccggctcggcgcgcccgtcggcgcccccgccgtc
ggcacacccgtcagccagggctggcgcgaccagctgcacgcggccctgatcggcctgggc
tacgccacccgcgaggccgacgaggcggtcgccgccgtcgccccgcaggccgaggccgcg
ggcggcacgccccaggtcgggcagttgctcaaggccgccctgcagaccctgaaccgcgcc
cgctga

DBGET integrated database retrieval system