KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3099Help
Entry
SHJG_3099         CDS       T02063                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SHJG_3099
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SHJG_3099
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJG_3099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3642000..3643538
Genome map
AA seq 512 aa AA seqDB search
MTDAHTAGPFIAAIDQGTTSSRCIVFDRDGRIVSVDQKEHEQIFPKPGWVEHNANEIWTN
VQEVVAGAIAKAGITRDDIKAIGITNQRETTVLWDKNTGEPVHNAIVWQDTRTDALCKEL
GRNVGQDRFRRETGLPLASYFAGPKARWLLDNVEGLKERAEAGDILFGTMDTWVIWNLTG
GVNGGKHVTDVTNASRTLLMNLHTMQWDEKICESIGVPLQILPEIRSSAEVYGEITGGKL
GDLLGGIPVASALGDQQAALFGQTCFSEGETKSTYGTGTFMVMNTGSKIINSYAGLLTTV
GYKIGDQPTVYALEGSIAVTGSLVQWMRDQMGLISTAAEIETLALSVEDNGGAYFVPAFS
GLFAPHWRSDARGVIAGLTRYVTKAHLARAVLEATAWQTREIADAMVKDSGDELVTLKVD
GGMTANNLLMQTLADVLDAPVVRPMVAETTCLGAAYAAGLAVGFWNSTDDLRANWRRAAE
WTPRMDAETRAREYKNWLKAVDRTMGWLEDES
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcccacaccgcaggccccttcatcgcggcgatcgaccagggcacgacctcc
tcgcgctgcatcgtcttcgaccgggacggccgcatcgtctccgtcgaccagaaggagcac
gagcagatcttcccgaagccgggctgggtcgagcacaacgccaacgagatctggaccaac
gtccaggaagtcgtcgccggcgccatcgccaaggccggcatcacccgcgacgacatcaag
gccatcggcatcaccaaccagcgcgagaccaccgtgctgtgggacaagaacaccggtgag
cccgtccacaacgccatcgtctggcaggacacccgcaccgacgcgctctgcaaggagctg
ggccgcaacgtcggccaggaccgcttccgccgcgagacgggcctgccgttggcctcctac
ttcgccgggcccaaggcccgctggctgctcgacaacgtcgagggcctgaaggagcgcgcc
gaggccggtgacatcctcttcggcaccatggacacctgggtcatctggaacctgaccggc
ggtgtcaacggcggcaagcacgtcaccgacgtcaccaacgcctcccgcaccctcctcatg
aacctgcacacgatgcagtgggacgagaagatctgcgagtccatcggcgtgccgctgcag
atcctgcccgagatccgctcctccgccgaggtctacggcgagatcacgggcggcaagctg
ggcgacctgctcggcggcatcccggtcgcctccgcgctcggcgaccagcaggcggccctg
ttcggccagacctgcttctccgagggcgagaccaagtcgacctacggcaccggcaccttc
atggtgatgaacaccggcagcaagatcatcaactcctacgccggtctgctgaccaccgtc
ggctacaagatcggcgaccagccgacggtctacgccctggagggctccatcgccgtcacc
ggctcgctggtgcagtggatgcgcgaccagatgggcctgatctccaccgcggccgagatc
gagacgctcgcgctctcggtcgaggacaacggcggcgcctacttcgtgccggccttctcc
ggcctgttcgccccgcactggcgctccgacgcccgcggtgtgatcgccggcctgacccgg
tacgtcaccaaggcgcacctcgcgcgcgccgtcctggaggccaccgcctggcagacccgg
gagatcgccgacgccatggtcaaggactccggcgacgagctggtgaccctgaaggtcgac
ggcggcatgaccgccaacaacctgctgatgcagaccctcgccgacgtcctcgacgcaccg
gtggtgcgcccgatggtcgccgagaccacctgcctcggcgccgcctacgccgccggtctc
gccgtcggcttctggaacagcaccgacgacctgcgcgccaactggcgccgggccgccgag
tggaccccccgcatggacgcggagacccgcgcccgtgagtacaagaactggctcaaggcc
gtcgaccggaccatgggctggctcgaagacgagagctga

DBGET integrated database retrieval system