KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3301Help
Entry
SHJG_3301         CDS       T02063                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:shy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3856790..3857506)
Genome map
AA seq 238 aa AA seqDB search
MAEALRNTDDGHQGGRQDGGQREVRQDEARLWAELVATARRTVADGLVVGTSGNVSARVG
DLVLVTPSGVPYDRLTPDDITGVDLTGRQVLGTLVPTSELPMHLAVYRTTDARAVVHTHA
VHATAVSTLVPELPPVHYMTVALGGPVRVAPYATYGTGELAENMLRALAGRSGCLLQNHG
TITYGATLDQAYDRTAQLEWMCRLWLTASCVPGLTPSLLTEAQLTEVGERLKGYGQRR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgctgcggaacacggacgacgggcaccagggcgggcggcaggacggcggg
cagcgggaggtgcgtcaggacgaggcgcggctctgggcggaactggtcgcgacggcgcgc
cgcaccgtcgccgacggactggtggtcggcacctccggcaacgtctccgcccgcgtcggg
gacctcgtcctggtgaccccgtccggagtcccctacgaccggctcaccccggatgacatc
accggcgtcgacctcaccggacgccaggtgctcggcacgctcgtgccgaccagcgagctg
cccatgcacctcgccgtctaccgcaccaccgacgcccgcgccgtcgtccacacccacgcc
gtgcacgcgaccgcggtctccacgctcgtgcccgaactgccgccggtccactacatgacc
gtcgccctcggcggccccgtccgggtcgccccctacgccacctacggcaccggcgaactg
gccgagaacatgctccgcgccctcgccggccgctccggctgcctcctccagaaccacggc
acgatcacctacggcgccaccctcgaccaggcctacgaccgcaccgcccagctggagtgg
atgtgccgcctgtggctcacggcgtcctgtgtgccgggcctgaccccgtccctgctgacg
gaggcacaactgaccgaggtcggggaacgcttgaagggatacggccaacggaggtga

DBGET integrated database retrieval system