KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3301Help
Entry
SHJG_3301         CDS       T02063                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SHJG_3301
Enzymes [BR:shy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SHJG_3301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3856790..3857506)
Genome map
AA seq 238 aa AA seqDB search
MAEALRNTDDGHQGGRQDGGQREVRQDEARLWAELVATARRTVADGLVVGTSGNVSARVG
DLVLVTPSGVPYDRLTPDDITGVDLTGRQVLGTLVPTSELPMHLAVYRTTDARAVVHTHA
VHATAVSTLVPELPPVHYMTVALGGPVRVAPYATYGTGELAENMLRALAGRSGCLLQNHG
TITYGATLDQAYDRTAQLEWMCRLWLTASCVPGLTPSLLTEAQLTEVGERLKGYGQRR
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgctgcggaacacggacgacgggcaccagggcgggcggcaggacggcggg
cagcgggaggtgcgtcaggacgaggcgcggctctgggcggaactggtcgcgacggcgcgc
cgcaccgtcgccgacggactggtggtcggcacctccggcaacgtctccgcccgcgtcggg
gacctcgtcctggtgaccccgtccggagtcccctacgaccggctcaccccggatgacatc
accggcgtcgacctcaccggacgccaggtgctcggcacgctcgtgccgaccagcgagctg
cccatgcacctcgccgtctaccgcaccaccgacgcccgcgccgtcgtccacacccacgcc
gtgcacgcgaccgcggtctccacgctcgtgcccgaactgccgccggtccactacatgacc
gtcgccctcggcggccccgtccgggtcgccccctacgccacctacggcaccggcgaactg
gccgagaacatgctccgcgccctcgccggccgctccggctgcctcctccagaaccacggc
acgatcacctacggcgccaccctcgaccaggcctacgaccgcaccgcccagctggagtgg
atgtgccgcctgtggctcacggcgtcctgtgtgccgggcctgaccccgtccctgctgacg
gaggcacaactgaccgaggtcggggaacgcttgaagggatacggccaacggaggtga

DBGET integrated database retrieval system