KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3308Help
Entry
SHJG_3308         CDS       T02063                                 

Definition
magnesium-chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJG_3308
Enzymes [BR:shy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SHJG_3308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3866694..3868700
Genome map
AA seq 668 aa AA seqDB search
MTTPFPFTAVVGQDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALLPQVAVVP
GCRFSCDPASPDPACPDGPHESGDGVERPARMVELPVGASEDRLVGALDIERALAEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASREPEQRVEVVRRRLAYDDDPAAFAARWAGEEAAVRQ
RIVAARELVPRVRLGDGALRQIAATCAAFEVDGMRADIVMARTATALAAWAGRTDVLAED
VRQAALLALPHRRRRNPFDAPGLDEDKLDETLEQFSGESPDDDPDPDGPGGPGGGGGQPA
PDSGPRDDGGSGARPEAGEGGQPQASGGQEQSAVRAAEPFRAKALTVPGVGEGAAGRRSR
ARTEHGRTTGARRPRGALTKLHLAATVQAAAPHQRARGRSGPGLVVRRDDLRQAVREGRE
GNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRDKVGLVTFRGSAAEVALPPTSS
VDAAAARLESLPTGGRTPLAAGLLKAHEVLRVERLRDPARRALVVVVTDGRATGGPEPVA
LAGRAARLFAAEQVASVVVDCESGPVRLGLAGELAGRLGGTAVTLDELRADSIAGLVRDV
QGTKRRAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccccgttcccctttacggccgtcgtcggccaggacgacctgcggctcgcgctg
ctgctgaacgccgtgtcgccggcggtcggcggtgtgctggtgcgcggcgagaagggcacc
gcgaagtccacggcggtacgggcgctctcggcgctgctgccgcaggtggccgtcgtcccc
gggtgccggttctcgtgtgacccggcctcccccgatcccgcctgcccggacgggccgcac
gagtccggcgacggcgtcgagcgccccgcgcggatggtcgaactgcccgtcggcgcctcc
gaggaccggctcgtcggcgccctcgacatcgagcgggcgctggccgagggcgtgaaggcc
ttcgagccgggcctgctggccgacgcgcaccggggcatcctctacgtcgacgaggtgaac
ctgctccacgaccacctggtcgatctgctgctggacgcggcggcgatgggtgcctcgtac
gtggagcgcgagggtgtgtccgtgcggcacgcggcccggttcctgctcgtcggcaccatg
aaccccgaagagggcgagctgcgcccgcagttgctggaccggttcgggctgaccgtggag
gtggccgcctcgcgggagccggagcagcgggtggaggtcgtgcggcgccggctggcgtac
gacgacgatccggccgccttcgccgcgcgctgggccggtgaggaggccgccgtacggcag
cggatcgtggcggcgcgggagttggtgccgcgggtgcggctgggcgacggggcgctgcgg
cagatcgcggcgacctgcgcggccttcgaggtggacggcatgcgcgccgacatcgtgatg
gcccgtacggcgaccgcgctggccgcgtgggccgggcggaccgatgtgctcgcggaggac
gtgcggcaggccgcgctgctggcgctcccccatcgcaggcggcgcaacccgttcgacgcg
ccggggctggacgaggacaagctggacgagacgctggagcagttctccggcgagtccccc
gacgacgatccggaccccgacggccccggtgggcccggtgggggcggcgggcagccggcg
cccgacagcggtccgcgggacgacggcggcagcggcgcgcggcccgaggccggcgagggc
gggcagccgcaggcgtccggcgggcaggagcagtcggccgtacgggccgccgaacccttc
cgtgccaaggcgctgaccgtcccgggcgtcggcgagggtgccgccgggcggcggtcgcgg
gcacggaccgagcacgggcggaccaccggggcccggcggccccggggcgccctgaccaag
ctgcacctggcggcgaccgtacaggccgccgcgccgcaccagcgggcgcggggcaggtcc
gggccggggctggtcgtgcggcgggacgatctgcggcaggcggtccgggaggggcgtgag
gggaacctcgtgctgttcgtggtggacgcctcgggctcgatggcggcgcggcagcggatg
agcgccgtgaagggggccgtgctgtcgctgctgctggacgcctaccagcggcgggacaag
gtggggctcgtgaccttccgggggtcggcggccgaggtcgcgctgcccccgacgtcctcc
gtcgacgccgccgccgcgcggctggagtcgctgcccaccggggggcgtacgccgctcgcc
gccgggctgctgaaggcgcacgaggtgctgcgggtggagcggctgcgggacccggcgcgc
cgggcgctggtggtcgtggtgaccgacggccgggccaccggcggcccggagccggtcgcc
ctcgcggggcgggcggcgcggctgttcgcggccgagcaggtcgcctcggtggtcgtggac
tgcgagtcggggccggtgcggctcgggctcgccggggagctggccggtcggctgggcggt
acggccgtcacgctggacgagctgcgggccgactcgatcgccgggctggtcagggatgtg
caggggacgaagaggagggccgcgtag

DBGET integrated database retrieval system