KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3401Help
Entry
SHJG_3401         CDS       T02063                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_3401
   01230 Biosynthesis of amino acids
    SHJG_3401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_3401
   00051 Fructose and mannose metabolism
    SHJG_3401
   00562 Inositol phosphate metabolism
    SHJG_3401
Enzymes [BR:shy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SHJG_3401
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SHJG_3401
  Exosomal proteins of bladder cancer cells
   SHJG_3401
  Exosomal proteins of melanoma cells
   SHJG_3401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3960092..3960868)
Genome map
AA seq 258 aa AA seqDB search
MSTRTPLMAGNWKMNLNHLEAIAHVQKLAFALADKDYEAVEVAVLPPFTDLRSVQTLVDG
DKLKIKYGAQDISQHDSGAYTGEISGPMLAKLKCTYVVIGHSERRQYHNETDELVNAKVK
AAYKHGLTPILCVGEELDVREAGDHVSHTLSQVEGGLKDLPAEQAETIVIAYEPVWAIGT
GKVCGAEDAQEVCAAIRAKIAELYSQDVADRVRIQYGGSVKSGNVAEIMSQADIDGALVG
GASLDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacgcgcacgccgctgatggcgggcaactggaagatgaacctcaaccaccttgag
gccatcgcacacgtccagaagctcgcgttcgccctggccgacaaggactacgaggccgtc
gaggtcgccgtcctgccgcccttcaccgacctgcgctccgtgcagaccctggtcgacggc
gacaagctcaagatcaagtacggcgcccaggacatctcccagcacgactccggcgcctat
acgggcgagatctccggcccgatgctggccaagctgaagtgcacctacgtggtgatcggc
cactccgagcggcgccagtaccacaacgagaccgacgagctggtcaacgccaaggtcaag
gccgcctacaagcacggcctcaccccgatcctgtgcgtcggcgaggagctggacgtccgc
gaggcgggcgaccacgtcagccacaccctcagccaggtcgagggcggtctcaaggacctg
ccggccgagcaggccgagaccatcgtgatcgcctacgagccggtgtgggccatcggcacc
ggcaaggtctgcggcgccgaggacgcccaggaggtctgcgccgccatccgcgccaagatc
gccgagctgtactcccaggacgtggccgaccgggtccgcatccagtacggcggctccgtg
aagtcgggcaacgtcgccgagatcatgtcccaggccgacatcgacggcgccctggtcggc
ggtgcttcgctggacgccgacgagttcgtcaagatcgtgcgcttccgcgaccagtga

DBGET integrated database retrieval system