KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3495Help
Entry
SHJG_3495         CDS       T02063                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SHJG_3495
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SHJG_3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4067122..4068879
Genome map
AA seq 585 aa AA seqDB search
MSAFAVGESGFLLDGRPVRLLSGALHYFRVHEDQWGHRLAMLRAMGLNCVETYVPWNLHE
PRPGVFRDVGAVGRFLDAVRGAGLWAIVRPGPYICAEWENGGLPVWLTGEPGTRARTRDE
RYLRHVRNWFQRLLPEIVPRQIDRGGPVVMVQVENEYGSYGSDTGHLEELAGVLRAEGVT
AALCTSDGPEDHMLTGGSLPGVLATVNFGSHARVAFETLRRHRPGGPLMCMEFWCGWFDH
WSGEHAVRDPAEAAEALREILECGASVNLYMAHGGTSFGGWAGANRGGGELHEGPLEPDV
TSYDYDAPVDEYGRPTEKFWRFREVLAAYRPGPLPDPPSRPAALAAPAGAELTGWAPPAD
VLEALGGPETAGPVPPTFEELGITRGLVRYTVDVPGPRRPYPLTVRGLRDLAVVYVNGER
AGVLTEAEPRLEEPVAGPARVELWVESLGRVNYGPRLGEAKGVTGGVLHERQYLHGVRAR
GLDLDAFAEGVDAVPFGPVPGDGAPGLYRGTVTVRGAGDARLELPGGTRGFVWINGFNLG
RYWAVGPQRSLYVPGPVLREGANEVWLLELDGGTPDGPAPRLVPV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgttcgcggtcggggagtccgggttcctgctggacgggcggccggtgcggctg
ctgtccggggcgctgcactacttccgggtgcacgaggaccagtgggggcaccggctggcg
atgctgcgggcgatgggcctgaactgtgtggagacgtacgtcccgtggaacctgcacgag
ccgcgtccgggcgtcttccgggacgtgggggcggtcggccggttcctggacgcggtccgc
ggggcgggcctgtgggcgatcgtgcggccggggccctacatctgcgccgagtgggagaac
ggcgggctgccggtgtggctgacgggcgagccgggcacgcgcgcgcgtacgcgtgacgag
cggtacctgcgccatgtccggaactggttccagcggctgctgcccgagatcgtgccccgc
cagatcgaccggggcggtccggtggtcatggtccaggtggagaacgagtacggcagctac
ggcagtgacaccggccatctggaggagctggccggcgtgctgcgcgccgagggggtcacc
gccgcgctgtgcacctcggacggccccgaggaccacatgctgaccgggggttcgctgccc
ggggtgctcgccacggtgaacttcggctcccacgcgcgcgtggccttcgagacgctgcgc
cgccaccgccccgggggcccgctgatgtgcatggagttctggtgcggctggttcgaccac
tggtccggtgagcacgccgtacgggatccggccgaggccgccgaggcgctgcgggagatc
ctggagtgcggggcgtcggtgaacctctacatggcgcacggcggcacgagcttcggcggc
tgggcgggcgccaaccggggcggcggcgagctgcacgagggcccgctggagccggacgtg
acctcgtacgactacgacgcgccggtggacgagtacggccgccccacggagaagttctgg
cgcttccgcgaggtgctggccgcgtaccggcccggcccgctgcccgacccgccctcgcgg
cccgccgcgctggcggccccggccggggcggagctcaccggctgggcgccgccggccgac
gtcctggaggcgctgggcggtccggagacggccggccccgtgccgcccacgttcgaggag
ctggggatcacccggggcctcgtgcgctacacggtggacgtgcccggcccccggcggccg
tacccgctgaccgtgcgcgggctgcgggatctcgcggtggtgtacgtcaacggggagcgg
gccggggtgctgacggaggcggagccgcggctggaggagccggtcgcgggccccgcgcgc
gtggagctgtgggtggagtccctggggcgggtgaactacgggccgcggctcggtgaggcg
aagggcgtcacgggcggcgtcctgcacgagcggcagtatctgcacggggtacgcgcgcgt
gggctggacttggacgcgttcgccgaaggggtggacgcggtgcccttcggcccggtgccc
ggggacggggcgccgggtctgtaccggggcacggtcacggtccgcggggccggggacgcg
cggctggagctgccgggcgggacgcggggcttcgtctggatcaacggtttcaacctggga
cgttactgggcggtgggcccgcagcggtcgctgtacgtccccgggccggtgctgcgggag
ggcgcgaacgaggtgtggctgctggaactggacggcggcacaccggacggaccggcaccg
cggctggtgccggtgtga

DBGET integrated database retrieval system