KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3513Help
Entry
SHJG_3513         CDS       T02063                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SHJG_3513
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_3513
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJG_3513
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SHJG_3513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4091016..4091834)
Genome map
AA seq 272 aa AA seqDB search
MSGNARLLSDTLAAAKAEGRSALIAYLPAGFPTVDGGIEAIKAVFDGGADVVEVGLPHSD
PVLDGPVIQTADDIALRGGVRIADVMRTVREAHEATGKPVLVMTYWNPIDRYGVERFTAE
LAEAGGAGCILPDLPVQESALWREHAEKHGLATVFVVAPSSKDERLAQITAAGSGFVYAA
SLMGVTGTRESVGTQAQDLVRRTRATGTDLPVCVGLGVSNRAQAAEVAGFADGVIVGSAF
VKRMLDAPDHASGLAAVRELAGELAKGVRGQA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggaacgcacggctgctgagcgacaccctcgccgccgccaaggccgagggccgc
tccgcgctcatcgcctacctcccggccggcttcccgaccgtggacggcggcatcgaggcg
atcaaggccgtcttcgacgggggcgccgacgtggtcgaggtcgggctgccgcacagcgac
ccggtgctcgacggcccggtcatccagaccgccgacgacatcgccctgcggggcggagtg
aggatcgccgacgtcatgcgcacggtccgggaggcccacgaggccaccgggaagccggta
ctcgtcatgacgtactggaaccccatcgaccgctacggcgtggagcggttcaccgccgag
ctggccgaggcgggcggcgcgggctgcatcctgcccgacctgcccgtgcaggagtcggcg
ctgtggcgggagcacgccgagaagcacggcctcgccacggtcttcgtcgtggcgccgagc
agcaaggacgagcggctcgcccagatcaccgcggcgggcagcggcttcgtgtacgcggcc
tccctcatgggcgtcaccggcacccgggaatccgtcggtacgcaggcccaggacctggtc
cggcgcacccgcgccaccggcaccgacctgcccgtctgcgtcggactcggcgtctccaac
cgggcccaggccgccgaggtcgccggcttcgccgacggcgtgatcgtcggctcggcgttc
gtgaagcggatgctggacgccccagaccacgcctccggtctcgcggcggtccgcgagctg
gccggtgagctggcgaaaggcgtgcgcggacaggcgtga

DBGET integrated database retrieval system