KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3514Help
Entry
SHJG_3514         CDS       T02063                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SHJG_3514
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_3514
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJG_3514
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SHJG_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4091831..4093114)
Genome map
AA seq 427 aa AA seqDB search
MPSEFFIPDPSGQVPSAEGYFGAFGGKFIPEALVAAVDEVAVEYDKAKHDPEFARELDDL
LVNYTGRPSALTEVPRFAEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKTRVI
AETGAGQHGVATATACALFGLDCTIYMGEVDTRRQALNVARMRMLGAEVVAVKSGSRTLK
DAINEAFRDWVANVDHTHYLFGTVAGPHPFPAMVRDFHRVIGVEARRQLLERAGRLPDAA
VACVGGGSNAIGLFHAFIPDEGVRLIGCEPAGHGVETGEHAATLTAGEPGILHGSRSYVL
QDDEGQITEPYSISAGLDYPGVGPEHSYLRDSGRGEYRAVTDDAAMQALRLLSRTEGIIP
AIESAHALAGALEVGKELGKDGLIVVNLSGRGDKDMDTAARYFGLYDTDAEVAANEADTA
EIEGDAK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcgagttcttcatccctgaccccagcggccaggtgcccagcgccgagggctac
ttcggcgcgttcggcggcaagttcatcccggaggccctcgtcgccgccgtggacgaggtg
gccgtcgagtacgacaaggccaagcacgaccccgagttcgcccgtgagctcgacgacctg
ctcgtcaactacaccggccgtccgtcggcgctcaccgaggtgccccgtttcgccgaacac
gccggtggcgcccgtgtgttcctcaagcgcgaggacctcaaccacaccggctcccacaag
atcaacaacgtgctcggccaggccctgctcaccaagcgcatgggcaagacccgggtcatc
gccgagaccggcgccggccagcacggtgtcgcgacggccaccgcctgcgcgctgttcggc
ctcgactgcaccatctacatgggcgaggtcgacaccaggcgccaggccctcaacgtggcc
cgtatgcgcatgctcggcgccgaggtcgtcgccgtgaagtccggcagccgcaccctcaag
gacgccatcaacgaggcgttccgggactgggtcgccaacgtcgaccacacccactacctc
ttcggcacggtcgccggcccgcacccgttccccgccatggtccgcgacttccaccgggtg
atcggcgtggaggcacggcgtcagctcctggagcgcgccggccgtctccccgacgcggcc
gtcgcctgcgtcggcggcggctccaacgccatcggcctcttccacgccttcatcccagac
gagggcgtccgcctcatcggctgcgagccggccggccacggcgtcgagaccggcgagcac
gcggccaccctcaccgccggcgagcccggcatcctgcacggctcccggtcgtacgtcctc
caggacgacgagggccagatcaccgagccgtactcgatctcggccgggctggactacccg
ggtgtcggcccggagcactcctacctccgtgactccggccgcggcgagtaccgcgcggtc
accgacgacgccgccatgcaggccctgcgcctgctgtcgcgcaccgagggcatcatcccg
gccatcgagagcgcccacgcgctggccggcgccttggaggtcggcaaggagctgggcaag
gacggcctgatcgtcgtcaacctgtccggccgcggcgacaaggacatggacaccgccgcc
cgctacttcggcctctacgacaccgacgccgaggtggccgccaacgaagccgacaccgcc
gagatcgagggggacgccaagtga

DBGET integrated database retrieval system