KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3515Help
Entry
SHJG_3515         CDS       T02063                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01130  Biosynthesis of antibiotics
shy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJG_3515
Enzymes [BR:shy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SHJG_3515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEY88787
UniProt: H2JVH3
Position
complement(4093439..4094248)
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIIDGVRADLAERQARVTLDELKERAAKAHAAKDGVAALKGDGVKVICEVKRSSP
SKGALAAIADPAGLAADYEAGGAAVISVLTEQRRFGGSLADLEAVRARVDIPVLRKDFIV
TSYQLWEARAYGADLALLIVAALDQPALESLIERAVSIGLTPLVEVHDEDEVERAVDAGA
KVIGVNARNLKTLEVDRGTFERVAPEIPDTIVKVAESGVRGPHDLIAYANAGADAVLVGE
SLVTGRDPKAAVADLVAAGEHPALRHGRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgctcgacgagatcatcgacggagtccgtgccgacctcgcggagcggcaggca
cgcgtcaccctcgacgagctcaaggagcgcgcggccaaggcccacgccgccaaggacggg
gtggccgcgctcaagggcgacggcgtcaaggtgatctgcgaggtgaagcgctccagcccc
tccaagggcgcgctggccgccatcgccgaccccgccggactcgccgcggactacgaagcg
ggcggcgcggccgtcatctccgtcctcaccgaacagcgccgcttcggcggttcgctcgcc
gacctggaggcggtgcgcgcgcgggtcgacatccccgtcctgcgcaaggacttcatcgtc
acgtcgtaccagctctgggaggcccgggcgtacggcgccgacctcgcgctgctgatcgtg
gccgccctggaccagccggccctggagtcgctgatcgagcgggcggtgtccatcggcctg
acccccctcgtcgaggtgcacgacgaggacgaggtggagcgggcggtggacgcgggcgcc
aaggtcatcggtgtcaacgcgcgcaacctgaagacgctggaggtcgaccgcggcacattc
gagcgggtcgccccggagatcccggacaccatcgtgaaggtcgccgagtccggcgtccgc
ggcccgcacgacctgatcgcgtacgccaacgccggcgccgacgcggtgctggtcggcgag
tccctggtgaccggccgcgaccccaaggcggcggtggccgacctggtggcggcgggcgaa
cacccggccctgcggcacgggcgcggctga

DBGET integrated database retrieval system