KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3532Help
Entry
SHJG_3532         CDS       T02063                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:shy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4105575..4106900)
Genome map
AA seq 441 aa AA seqDB search
MISRIDLRGDALPEGPALRDLLPRADFDVQAALEKVRPICEAVHHRGDAALIDFAEKFDG
VRLETVRVPAQALTDALAGLDPAVRAALEESIRRARLVHREQRRTTHTTQVVPGGSVTEK
WVPVERVGLYAPGGRSVYPSSVVMNVVPAQEAGVESIALASPAQAEFGGLPHPTILAACA
LLGVDEVYAAGGATAVAMFAYGTESCPPADMVTGPGNIWVAAAKRYFTGKIGIDAEAGPT
EIAILADAGADPVHVASDLISQAEHDPLAAAVLVTDSVELADAVEKELEPQVAATKHIED
RIVPALKGKQSAIVLVDGIDEGLRVVDAYGAEHLEIQTADAAAVADRVRNAGAIFIGPWA
PVSLGDYAAGSNHVLPTGGCACHSSGLSVQSFLRGIHIVDYTKDALAEVAHHVVTLAEAE
DLPAHGAAVKARFGWKVPESK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccgaatcgatctgcgcggcgacgcccttcccgagggccccgccctgcgcgac
ctgctgccccgagccgacttcgacgttcaggccgccctggagaaggtgcgcccgatctgc
gaggccgtgcatcatcgtggcgacgcggcgctgatcgacttcgccgagaagttcgacgga
gtacggctggaaaccgtccgtgtcccggcccaggcgctcaccgacgcgctcgccggactc
gacccggccgtgcgcgccgccctggaggagtccatccggcgcgcccggctggtccaccgc
gaacagcgccgtacgacccacaccacgcaggtcgtgcccggcggctcggtgaccgagaaa
tgggttccggtcgagcgcgtcgggctgtacgcgcccggcggccgctcggtctacccgtcc
tccgtggtgatgaacgtggtgcccgcccaggaggccggcgtcgagtccatcgcgctcgcc
tcaccggcccaggccgagttcggcgggctgccgcacccgacgatcctcgccgcctgcgcc
ctgctgggcgtggacgaggtgtacgcggccggcggcgccaccgccgtcgcgatgttcgcg
tacggcacggagtcctgcccgcccgccgacatggtcaccgggcccggcaacatctgggtc
gccgccgccaagcgctacttcaccggcaagatcggcatcgacgccgaggccggcccgacc
gagatcgcgatcctcgcggacgccggcgccgacccggtgcacgtcgcctccgacctgatc
agccaggccgagcacgacccgctggcggcggccgtcctggtcaccgactccgtcgagctg
gcggacgcggtcgagaaggagctggagccgcaggtcgcggccaccaagcacatcgaggac
cggatcgtgcccgcgctgaagggcaagcagtccgccatcgtgctggtcgacggcatcgac
gagggcctgcgggtcgtcgacgcgtacggcgccgagcacctggagatccagaccgccgac
gccgcggcggtggccgaccgggtccgcaacgccggcgcgatcttcatcggcccctgggcc
cccgtctcgctcggcgactacgcggccgggtccaaccacgtcctgcccaccggcggatgc
gcctgccactcctcgggcctgtccgtccagtccttcctgcgcggcatccacatcgtggac
tacacgaaggacgcgctcgccgaggtcgcccaccacgtggtgacgctggcggaggcggag
gacctgccggcgcacggcgcggcggtcaaggcgcggttcggctggaaggtacccgagagc
aagtga

DBGET integrated database retrieval system