KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3569Help
Entry
SHJG_3569         CDS       T02063                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SHJG_3569
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SHJG_3569
Enzymes [BR:shy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SHJG_3569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4148512..4150032)
Genome map
AA seq 506 aa AA seqDB search
MTYPGLPRPTTLPATPLAELAGQLGVTAPEAVAEVTGITHDSRAVRPGDLYAALPGARLH
GADFVTQAASLGAVAVLTDPTGAERAAASGLPVLVVEDPRGRMGELAATIYRHPGRDLLQ
IGITGTSGKTTTAYLVEGGLKTVRSTGLIGTVEIRIGDERIKSERTTPEATDLQALFAVM
REGGVEAVAMEVSSHALVLGRVDGCVFDVAVFTNLSPEHMEFHSDMEDYFRAKARLFTPE
RSAFGVVNADDEYGRRLAKEATVPVVTFSAEGHPDADWRAQDVQVGPMDSTFTVLGPNGE
RVHAKSPLPGPFNVANTLAAIVALAAAGLDPQTAADGIAAVPGVPGRLERVDAGQPYLAV
VDYAHKTDAVESVLKALRKVTKGRLHVVLGCGGDRDQTKRAPMGAAVARLADTAVLTSDN
PRSEDPLAILATMLQGAASVPAHERGEVLLFEDRAAAVAAAVGRAQAGDTVLVAGKGHEQ
GQDIAGVVRPFDDRQVLREAIQKTQG
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgacctatccgggactgccccggccgacgacgctccccgccacacccctcgcggagctc
gccggccagctgggtgtcaccgcgccggaagccgtcgccgaggtcacggggatcacccac
gactcgcgcgcggtccgccccggtgacctgtacgccgccctcccgggcgcccggctgcac
ggcgccgacttcgtcacccaggccgcgagcctgggcgccgtcgccgtgctcaccgatccc
acgggcgccgagcgcgccgccgcgtccgggctgcccgtcctggtggtcgaggacccgcgc
gggcggatgggagagctcgcggccacgatctaccgccacccgggccgcgacctgctccag
atcggcatcaccggcacctccggcaagaccaccaccgcctacctggtggaaggcggcctg
aagaccgtccggtcgaccggcctcatcggcaccgtcgagatccgcatcggcgacgagcgc
atcaagtccgagcgcaccacgcccgaagccaccgacctccaggccctgttcgccgtcatg
cgcgaagggggcgtcgaggcggtcgccatggaggtctccagccacgccctggtcctcggc
cgggtcgacggctgcgtcttcgacgtcgccgtcttcaccaacctcagcccggaacacatg
gagttccactccgacatggaggactacttccgggccaaggcacggctgttcacgccggaa
cgcagcgcgttcggcgtggtcaacgccgacgacgagtacggccgccggctcgcgaaggag
gcgaccgtgccggtcgtcaccttctccgccgagggccacccggacgccgactggcgcgcc
caggacgtccaggtcggccccatggactcgacgttcaccgtgctgggtccgaacggcgag
cgcgtgcacgccaagtcgccgctgccgggccccttcaacgtggcgaacaccctcgccgcc
atcgtcgccctcgccgcggccggcctcgacccgcagaccgccgccgacggcatcgccgcc
gtcccgggcgtcccgggccgcctggagcgcgtcgacgccgggcagccctacctggcggtg
gtcgactacgcccacaagaccgacgccgtcgagtcggtgctcaaggcgctgcgcaaggtc
accaaggggcggctgcacgtcgtcctcggctgcggcggcgaccgcgaccagaccaagcgc
gccccgatgggcgccgccgtggcccggctcgccgacacggccgtactgacctccgacaac
ccccgctccgaggatcccctcgcgatcctcgcgaccatgctccagggcgcggcctccgtg
cccgcgcacgagcgcggcgaggtcctcctcttcgaggaccgggccgccgccgtggccgcc
gccgtgggccgcgcccaggccggcgacaccgtgctggtcgcgggcaagggccacgagcag
ggccaggacatcgccggcgtggtccgtcccttcgacgaccgccaggtgcttcgcgaagct
atccagaagacccagggatga

DBGET integrated database retrieval system