KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3606Help
Entry
SHJG_3606         CDS       T02063                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4189177..4189965
Genome map
AA seq 262 aa AA seqDB search
MKHMPVLPGAEPYRHEGGEVGVLLCHGFTGSPQSLRPWAEHHAAHGLTVSLPLLPGHGTR
WEDMQLTTWQDWYAQVDRELRLLTERCSRVFVAGLSMGGALALRLAARHGERVAGAVVVN
PANKVHGLSAYALPVARHLVRTTKGIASDIAKEGAAELGYDRVPLHAAHSLRVFLRRLDG
ELPRVTQPLLLLRSARDHVVPAADSARVLSRVSATDVTEIVLEHSYHVATLDNDADRIFE
ESLAFIGRLAPSVGKEGTAAVG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcacatgccagttctccccggagccgagccgtaccgccacgagggcggtgaggtg
ggggttctcctctgccacggcttcaccggctcgccccagtcgctgcgcccctgggcggag
caccacgcggcccacggcctgaccgtctccctgccgctgctgcccggccacggcacccgc
tgggaggacatgcagctcaccacctggcaggactggtacgcgcaggtggaccgtgaactg
cggctgctcaccgagcgctgctcccgggtgttcgtcgcgggcctgtcgatgggcggggcg
ctggccctcaggctcgcggcccggcacggcgagcgggtggcgggcgcggtggtcgtcaac
ccggccaacaaggtgcacggcctgtcggcgtacgcccttccggtggcccggcacctggtg
cggacgacgaaaggcatcgccagcgacatcgcgaaggagggcgcggccgagctggggtac
gaccgggtgccgctgcacgcggcgcactcgctgcgggtgttcctgcgccggctggacggc
gagctgccccgggtcacgcagccgctgctgctgctgcgcagcgcccgggaccatgtcgtc
ccggcggccgactcggcgcgggtgctgagccgggtgtcggccacggacgtcacggagatc
gtgctggaacacagctaccacgtggcgacgttggacaacgacgcggaccggatcttcgag
gagagcctcgccttcatcggccggctcgcacccagtgtcggcaaggaagggacggccgca
gttggctga

DBGET integrated database retrieval system