KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3660Help
Entry
SHJG_3660         CDS       T02063                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_3660
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJG_3660
  Amino acid metabolism
   00310 Lysine degradation
    SHJG_3660
Enzymes [BR:shy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SHJG_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4250345..4251781
Genome map
AA seq 478 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPASGVLASIK
VAEDETVEVGAELALIDDGTGAPAAAPAPAAAEAPAATPAPAATPAPAPAPAAAPAPAPA
PAAPAPAPAPAPAPVAAAPAPAPAPAPAPVTPATAPTSPTATQATDEGAYVTPLVRKLAA
ENGVDLATVKGTGVGGRIRKQDVIAAAEAAKAAAAAPAPAPAAAAPAAARKAPALEVSPL
RGQTVKMPRIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMKLRAKAKDSFAAREGVKLSP
MPFFVKAAAQALKAHPVINAKINEAEGTITYFDTENIGIAVDSEKGLMTPVIKHAGDLNI
AGIAKATAELAGKVRASKITPDELSGATFTISNTGSRGALFDTIIVPPGQVAILGIGATV
KRPAVIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaacccttccggcgctcggtgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggcgaacgcgtcgaggccgacgagccgctgctcgaagtctcg
accgacaaggtcgacaccgagatcccggccccggcctccggcgtgctggcctccatcaag
gtcgccgaggacgagacggtcgaggtcggcgccgagctggccctgatcgacgacggcacg
ggtgccccggccgccgccccggcccccgccgccgccgaggcccccgccgccaccccggcc
cccgccgccaccccggcgcccgcgcccgccccggctgccgccccggccccggctccggcc
cccgccgctccggccccggcgcccgccccggccccggcgcccgtcgccgctgccccggcc
cccgcaccggcgcccgccccggctccggtcaccccggccaccgccccgacctccccgacc
gccacccaggcgacggacgagggcgcgtacgtcaccccgctggtgcgcaagctcgccgcc
gagaacggcgtcgacctggccaccgtcaagggcaccggcgtcggcggccgtatccgcaag
caggacgtcatcgccgccgccgaggccgcgaaggccgccgccgctgccccggctccggct
ccggccgccgccgccccggccgccgccaggaaggccccggcgctggaggtctccccgctg
cgcggccagaccgtcaagatgccgcgcatccgcaaggtcatcggcgacaacatggtcaag
gcgctgcacgagcaggcccagctgtcgtcggtcgtcgaggtcgacgtcacccgcctgatg
aagctgcgcgccaaggcgaaggactccttcgcggcccgcgagggcgtcaagctctccccg
atgccgttcttcgtcaaggccgccgcccaggcgctgaaggcccacccggtcatcaacgcc
aagatcaacgaggccgaggggaccatcacctacttcgacaccgagaacatcggtatcgcg
gtggactccgagaagggcctgatgaccccggtcatcaagcacgccggcgacctcaacatc
gcgggcatcgccaaggccacggccgagctggcgggcaaggtccgggccagcaagatcacc
ccggacgagctgtccggcgcgaccttcaccatctccaacaccggttcgcgcggcgcgctg
ttcgacacgatcatcgtgccgccgggccaggtcgcgatcctcggcatcggtgccacggtc
aagcgtccggccgtcatcgagaccgaggagggcacggtcatcggcgtccgcgacatgacc
tacctgaccctctcctacgaccaccgcctggtcgacggcgccgacgcggcccgttacctg
acggcggtcaaggcgatcctggaggcgggcgagttcgaggtcgagctcggcctgtaa

DBGET integrated database retrieval system