KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_3898Help
Entry
SHJG_3898         CDS       T02063                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_3898
   00052 Galactose metabolism
    SHJG_3898
Enzymes [BR:shy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SHJG_3898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4493273..4494421
Genome map
AA seq 382 aa AA seqDB search
MELNRRTVIAGTAAAGLAATALGGAAEAASGRKPVRELFGTLADGTKVYRWSLENGGTRL
KVLSYGGIVQTLELPDRHGRYANVVAGFDDIADYVAKSPYFGALIGRYGNRIGKGQFTLD
GKSYQLSVNDGANSLHGGAQGFDKHVWDVEPFAKGSDVGLHLHYTSVDGEMGYPGTLRTT
VTYTLTRHGDWRIDYAATTDKATVVNLTSHVYWNLAGEGSGTIEDHELTIAASRYTPTDS
GLIPTGELAGVAGTPFDFRHAKPVGRDLRAGHEQQVLAKGYDHNWVLDKGITARPEHVAT
LRDPRSGRTLKIATDQPGLQFYSGNFLDGTLTGTGGRTYRQGDALCLETQHFPDSPNQAN
FPSTVLRPGQTYRTSTLHTFGA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaacagacgcacggtcatcgcgggaacagcagcggcgggcctcgccgccacc
gccctcggcggcgccgccgaagccgcctcgggcaggaagccggtgagggaactcttcggc
accctcgccgacggcacgaaggtgtaccgctggtcgctggagaacggcggcacccggctg
aaggtcctgtcctacggcggcatcgtccagaccctggagctgcccgaccggcacggccgg
tacgccaacgtcgtggccggcttcgacgacatcgccgactacgtggcgaagagcccgtac
ttcggcgccctgatcggccggtacggcaaccgcatcgggaagggacagttcacgctggac
ggcaagtcctaccagctctccgtgaacgacggcgccaacagcctgcacggcggggcccag
ggcttcgacaagcacgtgtgggacgtggagccgttcgccaagggctccgacgtcgggctg
cacctgcactacacgagcgtcgacggcgagatgggctacccgggcacgctgcggacgacg
gtgacgtacaccctcacccggcacggcgactggcgcatcgactacgcggccaccaccgac
aaggccaccgtcgtcaacctcaccagccacgtctactggaacctggccggtgagggcagc
ggcacgatcgaggaccacgaactcacgatcgccgcctcccggtacaccccgaccgactcc
ggcctgatccccaccggcgagctggccggggtcgcgggcaccccgttcgacttccggcac
gccaagcccgtcggccgggacctcagggcgggccacgagcagcaggtgctggccaagggg
tacgaccacaactgggtgctggacaaggggatcacggcgcggcccgagcacgtcgccacc
ctgcgcgacccgcgctccggccgcaccctgaagatcgccaccgaccagccgggcctccag
ttctactccggcaacttcctcgacgggacgctcaccggcaccggtggccgcacctaccgg
cagggcgacgccctgtgcctggagacgcagcacttcccggactcgccgaaccaggcgaac
ttcccgtcgacggtgctgcggccggggcagacgtaccggacgtcgaccctccacaccttc
ggggcgtga

DBGET integrated database retrieval system