KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4249Help
Entry
SHJG_4249         CDS       T02063                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SHJG_4249
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SHJG_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4892731..4893633
Genome map
AA seq 300 aa AA seqDB search
MYDYDLLVVGSANADLVIGVERRPAAGETVLGGDLAVHPGGKGANQAVAAARLGAATALL
ARVGDDGHGRLLLDSLRAAGVDTVGVLVGGAPTGVALITVDPSGDNSIVVSPGANSRLLP
ADVRAAAGVLRASRVVSAQLEIPLETVVEVVRNLAPGSRFVLNPSPPRELPAEVLAACDP
LILNEHEARVVLGDACASDDPEDWARLLLARGPRSVVVTLGAEGALVADGSGATRVPSVT
VDAVDTTGAGDAFTAALAWKLGSGADLADAAAYAARVGAAAVTRRGAQESYPTAEEVEAL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactacgaccttctggtcgtgggatcggccaatgccgacctggtgatcggcgtc
gagcggcggccggccgccggcgagacggtgctcggcggcgatctggccgtgcacccgggc
ggcaagggcgccaaccaggcggtcgccgcggcccggctcggcgccgccacggccctgctg
gcgcgggtcggcgacgacggccacggccggctgctgctcgactccctgcgcgcggccggg
gtcgacacggtgggcgtgctggtgggcggggccccgacgggggtcgcgctgatcaccgtc
gacccgtccggcgacaacagcatcgtggtgtcgccgggcgccaactcccgcctgctgccg
gcggacgtccgggcggcggcgggcgtcctgcgcgcctcccgcgtggtgtcggcgcagctg
gagatcccgctggagacggtcgtggaggtcgtacggaacctggcgccgggcagtcgcttc
gtgctgaacccgtcgccgccgcgcgagctgcccgcggaggtgctggcggcgtgcgacccg
ctgatcctcaacgagcacgaggcacgggtggtcctcggggacgcctgtgcgagcgacgat
cccgaggactgggcccggctgctgctggccaggggtccccgctcggtggtggtgacgctg
ggcgcggagggggcgctggtggccgacggctcgggggcgacccgggtgccgtcggtgacg
gtggacgcggtggacaccacgggtgccggggacgcgttcacggccgccctggcctggaag
ctcgggtccggtgcggacctggcggacgcggcggcctacgcggcccgcgtcggcgcggcg
gccgtgaccaggcggggcgcgcaggagtcgtacccgacggcggaggaggtcgaggccctg
tga

DBGET integrated database retrieval system