KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4269Help
Entry
SHJG_4269         CDS       T02063                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00330  Arginine and proline metabolism
shy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SHJG_4269
Enzymes [BR:shy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SHJG_4269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 DUF3373
Motif
Other DBs
NCBI-ProteinID: AEY89541
UniProt: H2JKK2
Position
complement(4916448..4917428)
Genome map
AA seq 326 aa AA seqDB search
MSSNETPRGPVDSSRVPRYAGPATFARLPRLDEVGTADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADGGDIAVNPFNINEAVETIEAAADDLLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGIL
DTSALSHVGTRGPLYGKQDLTDDEKMGFGIVTSADVYRRGADEVADQLRQRIGDRPLYIS
IDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLAGCNLVSADVVEVAPAYDHAEITSVA
ASHTAYELTTIMSRRIAAARKDAEAK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgagacgccccgcggccccgtcgactcctcccgcgtcccgcggtacgcc
ggacccgcgaccttcgcccggctgccccgcctggacgaggtcggcaccgccgacgtcgcc
gtcgtgggcgtgccgttcgactccggcgtctcgtaccggccgggcgcccgcttcggcggc
aacgccatccgcgaggcgtcccggctgctgcgcccctacaacccggcgcaggacgcctcc
ccgttcgccctcgcccaggtcgcggacggcggcgacatcgccgtgaaccccttcaacatc
aacgaggccgtcgagaccatcgaggccgccgccgacgacctgctcggcaccggcgcccgt
ctgatgaccctcggcggcgaccacaccatcgcgctgccgctgctgcgctcggtggcgaag
aagcacggcccggtcgccctgctgcacttcgacgcccacctggacacctgggacacctac
ttcggcgccgagtacacgcacggcaccccgttccgccgcgcggtcgaggagggcatcctc
gacacctccgccctgtcccacgtcggcacccgcggcccgctgtacggcaagcaggacctg
acggacgacgagaagatgggcttcggcatcgtcacctccgccgacgtctaccgccggggc
gccgacgaggtggccgaccagctgcgccagcgcatcggcgaccgaccgctgtacatctcc
atcgacatcgactgcctcgacccggcccacgcccccggcaccggcacgccggaggcgggc
ggcatgacctcccgcgagctgctggagatcctgcgcgggctggccggctgcaacctggtg
tcggcggacgtcgtcgaggtggccccggcgtacgaccacgccgagatcacctcggtcgcc
gcctcccacacggcgtacgaactgaccaccatcatgagccgccggatcgcggcggcccgg
aaggacgcggaagcgaagtga

DBGET integrated database retrieval system