KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4395Help
Entry
SHJG_4395         CDS       T02063                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SHJG_4395
Enzymes [BR:shy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SHJG_4395
    3.5.1.-  
     SHJG_4395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5049998..5050591
Genome map
AA seq 197 aa AA seqDB search
MRRALIVVDVQNDFCEGGSLAVAGGADVAAAITELIGQAAGTGYRHVVATRDHHIAPGGH
FADNPDYVRSWPAHCVAGTEGVGFHPNFAPAVASGAVDAVFDKGAYAAAYSGFEGTDENG
VPLADWLRAREITEVDVVGIATDHCVRATALDAAREGFRTQVLLDLTAGVAGETTERALE
ELREAGVELTGKPVVSG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccttgatcgtcgtagacgtgcagaacgacttctgcgaggggggcagcctc
gcggtggccggcggtgccgacgtggccgccgccatcaccgagctgatcggccaggcggcg
ggcaccggataccggcatgtggtggccacccgcgaccaccacatcgcgcccggcggccac
ttcgcggacaaccccgactacgtccgctcctggcccgcgcactgcgtcgcgggcacggag
ggggtgggcttccacccgaacttcgccccggccgtcgcctccggcgcggtggacgccgtc
ttcgacaagggtgcctacgcggccgcgtacagcggcttcgagggcacggacgagaacggc
gtccccctggccgactggctccgcgcgcgggagatcacggaggtggacgtggtgggcatc
gccacggaccactgcgtacgggccacggccctggacgccgcgcgcgagggcttccgcacg
caggtcctgctggacctgacggccggggtggcgggcgagaccaccgagcgggccctggag
gagctgcgggaagcgggcgtggaactcaccggcaagcccgtggtgagcggctag

DBGET integrated database retrieval system