KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4430Help
Entry
SHJG_4430         CDS       T02063                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJG_4430
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SHJG_4430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5090543..5091694
Genome map
AA seq 383 aa AA seqDB search
MYDEEQHPEHGPLAGFTVGVTAARRAEELGALLQRRGATVVHAPALRIVPLADDGELLAA
TKELIDQVPDVVVATTAIGFRGWVEAADGWGLGEQLLGRLRGVRLLARGPKVKGAIRAAG
LTEEWSPSSESLAEVLDRLLEEGVEGDRVAVQLHGEPLPGFVESLRAAGAEVVPVPVYRW
MPPEDLSPLDRLLDAAVTRGVDALTFTSAPAAASLLSRAEDRGLLDDLLAALAHDVLPAC
VGPVTAIPLQARGVDTVQPERFRLGPLVQLLCQELPARARSLPIAGHRVEIRGHAVLVDG
DLKPVPPAGMSLLRALARRPGWVVPRADLLRALPGAGRDEHAVETAMARLRTALGTPKLI
QTVVKRGYRLALDPAADAKYADA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgaagagcagcaccccgagcacggccccctcgccgggttcaccgtgggcgtc
accgccgcgcgccgggccgaggaactgggcgccctgctccagcggcgcggcgccaccgtt
gtgcacgcccccgccctgcggatcgtgccgctcgcggacgacggcgaactgctcgccgcc
acgaaggagctcatcgaccaggtgccggacgtcgtggtcgccaccacggcgatcggcttc
cgcggctgggtcgaggccgccgacggctggggcctgggcgaacagctgctgggccggctg
cgcggggtccgcctgctggcccgcgggcccaaggtgaagggcgcgatccgcgcggcgggg
ctcaccgaggaatggtcgccctcctcggaatccctggccgaggtactcgaccgcctcctg
gaggagggcgtcgagggcgaccgcgtcgccgtacaactccacggcgagcccctccccggc
ttcgtggagtcgctgcgggccgccggggcggaagtggtgcccgtcccggtctaccgctgg
atgccccccgaggacctcagccccctcgaccgcctcctggacgcggccgtcacccgtggc
gtggacgccctcaccttcaccagcgcccccgccgcggcctccctcctgtcccgcgcggag
gaccgcggcctgctggacgacctgctggccgccctggcccacgacgtcctcccggcctgt
gtcggcccggtcaccgcgatccccctccaggcccgcggagtggacacggtccagcccgaa
cgcttccgcctcggcccgctggtccagctcctgtgccaggaactcccggcccgcgcccgc
tccctgcccattgccggacaccgggtggagatccgcggccacgcggtcctggtcgacggc
gacctcaagccggtccccccggccggcatgtccctcctgcgcgccctggcccgccgcccc
ggctgggtcgtcccccgcgccgacctcctgcgcgcgctgccgggcgcgggccgcgacgag
cacgccgtcgagacggcgatggcccgcctccgcacggccctcggcaccccgaagctgatc
cagacggtggtgaagcggggctaccgcctggccctggacccggcggcggacgcgaagtac
gcggacgcgtga

DBGET integrated database retrieval system