KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4562Help
Entry
SHJG_4562         CDS       T02063                                 

Definition
hydrolase
Orthology
K01524  
exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SHJG_4562
Enzymes [BR:shy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     SHJG_4562
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     SHJG_4562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5256408..5257340)
Genome map
AA seq 310 aa AA seqDB search
MAAIDCGTNSIRLLVADADPATGELTDLDRRMTIVRLGQGVDRTGRLAPEALERTFAACR
EYADVIKEHGAERLRFVATSASRDAENREDFVRGVLDILGVEPEVITGDQEAEFSFTGAT
KELTGRSDLTRPYLVVDIGGGSTEFVVGGDHVRAARSVDVGCVRMTERHLVHGGEVSDPP
TEEEIAAMRADIEAALDLAEQSVPLREAHTLVGLAGSVTTVSAIAQELPAYDSARIHHSR
VSRDRVREITERLLRSTHAERAAIPSLHPGRVDVIGAGALVLLAIMERIGAEEVVVSEHD
ILDGIGWSLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccatcgactgcggtaccaactccatccgtctgctggtcgcggacgccgacccg
gcgacgggcgaactgaccgacctggaccgccggatgacgatcgtgcggctcggccagggg
gtcgaccgcaccggccggctcgcgcccgaggcactggagcgcaccttcgccgcctgccgt
gagtacgcggacgtcatcaaggagcacggcgccgagcgcctgcggttcgtcgccacctcc
gcctcccgcgacgccgagaaccgcgaggacttcgtgcgcggtgtgctggacatcctcggg
gtcgagccggaggtcatcaccggtgaccaggaggccgagttctccttcacgggtgccacg
aaggagctcaccggccgcagcgacctcacccggccctacctggtcgtggacatcggcggc
ggctccaccgagttcgtcgtcggcggcgaccacgtgcgcgccgcccggtcggtggacgtc
ggctgtgtacggatgaccgagcggcacctggtgcacggcggcgaggtgagcgacccgccc
accgaggaggagatcgccgccatgcgggccgacatcgaggccgccctggacctcgccgag
cagtcggtcccgctgcgcgaggcgcacaccctggtgggcctggccgggtccgtcaccacg
gtctccgccatcgcccaggaactgcccgcgtacgactccgcgcgcatccaccactcccgg
gtctcccgggaccgcgtgcgcgagatcaccgaacggctgctgcgctccacgcacgccgag
cgcgcggcgatcccctccctgcacccgggccgggtcgacgtcatcggcgcgggcgccctc
gtgctgctcgcgatcatggagcggatcggcgccgaggaggtcgtggtgagcgagcacgac
atcctggacgggatcggctggtctttggcctga

DBGET integrated database retrieval system