KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4600Help
Entry
SHJG_4600         CDS       T02063                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:shy01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:shy01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5303651..5304658
Genome map
AA seq 335 aa AA seqDB search
MTSSSDVIDEARKATDTPPPSATLGGEQKRSIEQITLLLFITVPFLALVAAVPLAWGWGV
SWLDLGLLVFFYFLGCHGITIGFHRYFTHGSFKAKRPLRIALAIMGSLAVEGPLVRWVAD
HRKHHKFSDAEGDPHSPWRFGETLPALMKGLWWAHIGWMFDEEQTPQDKYAPDLIKDPAM
RAISRQFVLWTAVSLGLPPLIGGLATMSWWGAFTGFFWGSLVRVALLHHVTWSINSICHA
VGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQIDSSARFIRIFELL
GWAYDVRWPSRSRIDSRRHTGEGGSRRRGETAEAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaagttccgatgtgatcgacgaagcccgtaaggccaccgacacaccccctccc
tccgccacgctgggcggcgagcagaagcgttcgatcgagcagatcacgctgctcctgttc
atcaccgtgccgttcctggcactggtggcggccgtgccgctggcctggggctggggggtg
agctggctcgatctgggcctgctggtcttcttctacttcctgggctgccacggcatcacg
atcggtttccaccggtacttcacccacggttcgttcaaggcgaagcggcccctgcggatc
gcgctcgcgatcatgggttcgctggcggtcgaggggccgctggtgcgctgggtggccgat
caccgcaagcaccacaagttctccgacgcggagggcgacccgcactccccgtggcggttc
ggcgagacgctcccggcgctgatgaagggcctgtggtgggcgcacatcggctggatgttc
gacgaggagcagaccccgcaggacaagtacgcgccggatctgatcaaggacccggcgatg
cgggcgatctcccggcagttcgtgctgtggacggccgtgtccctggggctgccgccgctg
atcggcggtctggcgacgatgtcctggtggggcgcgttcaccgggttcttctggggttca
ctcgtccgggtggcgctgctgcaccatgtgacgtggtcgatcaactcgatctgccacgcg
gtcggcaagcggccgttcaagtcgcgggaccgttcgggcaacgtgtggtggctggcggtg
ctgtcctgcggtgagtcctggcacaacctgcaccacgccgacccgacgtcggcgcggcac
ggtgtgatgcgcggccagatcgactcctcggcccgcttcatccgcatcttcgagctgctc
ggctgggcgtacgacgtgcgctggccgtcacgctcgcgtatcgattcgcggcgtcacacc
ggggaaggcggctcccggcgccggggggagacggccgaggcggcatga

DBGET integrated database retrieval system