KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4600Help
Entry
SHJG_4600         CDS       T02063                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SHJG_4600
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SHJG_4600
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SHJG_4600
Lipid biosynthesis proteins [BR:shy01004]
 Desaturase
  First
   SHJG_4600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5303651..5304658
Genome map
AA seq 335 aa AA seqDB search
MTSSSDVIDEARKATDTPPPSATLGGEQKRSIEQITLLLFITVPFLALVAAVPLAWGWGV
SWLDLGLLVFFYFLGCHGITIGFHRYFTHGSFKAKRPLRIALAIMGSLAVEGPLVRWVAD
HRKHHKFSDAEGDPHSPWRFGETLPALMKGLWWAHIGWMFDEEQTPQDKYAPDLIKDPAM
RAISRQFVLWTAVSLGLPPLIGGLATMSWWGAFTGFFWGSLVRVALLHHVTWSINSICHA
VGKRPFKSRDRSGNVWWLAVLSCGESWHNLHHADPTSARHGVMRGQIDSSARFIRIFELL
GWAYDVRWPSRSRIDSRRHTGEGGSRRRGETAEAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaagttccgatgtgatcgacgaagcccgtaaggccaccgacacaccccctccc
tccgccacgctgggcggcgagcagaagcgttcgatcgagcagatcacgctgctcctgttc
atcaccgtgccgttcctggcactggtggcggccgtgccgctggcctggggctggggggtg
agctggctcgatctgggcctgctggtcttcttctacttcctgggctgccacggcatcacg
atcggtttccaccggtacttcacccacggttcgttcaaggcgaagcggcccctgcggatc
gcgctcgcgatcatgggttcgctggcggtcgaggggccgctggtgcgctgggtggccgat
caccgcaagcaccacaagttctccgacgcggagggcgacccgcactccccgtggcggttc
ggcgagacgctcccggcgctgatgaagggcctgtggtgggcgcacatcggctggatgttc
gacgaggagcagaccccgcaggacaagtacgcgccggatctgatcaaggacccggcgatg
cgggcgatctcccggcagttcgtgctgtggacggccgtgtccctggggctgccgccgctg
atcggcggtctggcgacgatgtcctggtggggcgcgttcaccgggttcttctggggttca
ctcgtccgggtggcgctgctgcaccatgtgacgtggtcgatcaactcgatctgccacgcg
gtcggcaagcggccgttcaagtcgcgggaccgttcgggcaacgtgtggtggctggcggtg
ctgtcctgcggtgagtcctggcacaacctgcaccacgccgacccgacgtcggcgcggcac
ggtgtgatgcgcggccagatcgactcctcggcccgcttcatccgcatcttcgagctgctc
ggctgggcgtacgacgtgcgctggccgtcacgctcgcgtatcgattcgcggcgtcacacc
ggggaaggcggctcccggcgccggggggagacggccgaggcggcatga

DBGET integrated database retrieval system