KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4619Help
Entry
SHJG_4619         CDS       T02063                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:shy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5322512..5323405)
Genome map
AA seq 297 aa AA seqDB search
MSVTVRVPAKVNVQLAVGAARPDGFHDLANVFLAVGLYDEVTVTPADELRITCEGPDAAQ
VPLDRTNLAARAAIALAARRGIEPNVHVHIAKDIPVAGGMAGGSADGAGALLACDRLWGT
GASRAELLTICAELGSDVPFSLVGGVALGVGRGERLTSLEAGGTFHWVFAMAEGGLSTPA
VFREFDRLAEGREIPEPVASAELVEALAKGDAEALAASVSNDLQPAALSLFPELADTLAA
GRGAGALAALVSGSGPTTAFLARDAESAQTVAGALRASGTCRAVRVAAGPVAGATVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcacggtacgggtcccggccaaggtcaacgtccagctcgcggtcggcgccgcc
cgccccgacggcttccacgacctcgccaacgtcttcctcgccgtcggactgtacgacgag
gtcaccgtgacccccgcggacgaactccggatcacctgcgagggcccggacgccgcccag
gtcccgctggaccgcaccaacctcgccgcgcgcgccgcgatcgcgctcgccgcgcgccgg
gggatcgaaccgaacgtccacgtccacatcgccaaggacatcccggtcgccggtggcatg
gcgggcggcagcgcggacggcgcgggcgcgctgctcgcctgcgaccggctgtggggcacg
ggcgcctcgcgcgccgaactgctcacgatctgcgccgagctgggcagtgacgtgccgttc
agcctggtcggcggggtggcgctgggagtggggcgcggggagcggctgacctcgttggag
gccggcggaaccttccactgggtgttcgcgatggcggaggggggcctgtcgaccccggcg
gtgttccgcgagttcgaccggctggccgaggggcgggagatcccggagccggtggcgtcg
gcggagctggtggaggcgctggcgaagggggacgccgaggcgctggccgcgtccgtctcc
aacgatctccagccggccgcgctgtccctcttccccgagctggccgacacgctggcggcg
gggcgcggggcgggcgcgctcgccgcgctggtctccggttccggtcctacgacggcgttc
ctcgcgcgggacgccgagtcggcgcagacggtggccggggccctgcgggcgtcggggacg
tgccgggcggtgcgggtggcggcggggccggtggcgggggcgacggtgctctga

DBGET integrated database retrieval system