KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4652Help
Entry
SHJG_4652         CDS       T02063                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SHJG_4652
   00052 Galactose metabolism
    SHJG_4652
   00500 Starch and sucrose metabolism
    SHJG_4652
   00520 Amino sugar and nucleotide sugar metabolism
    SHJG_4652
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SHJG_4652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5358407..5359222)
Genome map
AA seq 271 aa AA seqDB search
MLPVVDKPAIQYVVEEAVSAGLDDVLMITGRNKRPLEDHFDRNYELESALEKKGDAERLA
KVQESSDLATMHYVRQGDPKGLGHAVLCAAPHVGHEPFAVLLGDDLIDPRDPLLARMIEV
QERHGGSVVALMEVAPEQIHLYGCAAVEATADGDVVKVTGLVEKPDPADAPSNYAIIGRY
VLDPHVFGILRTTEPGRGGEIQLTDALQQLAQDEKVGGPVHGVVFKGRRYDTGDRGDYLR
AIVRLACEREDLGPDFRTWLRSYVAEEMQES
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggtcgtagacaagccggcgatccagtacgtggtcgaggaggccgtgtcggcg
gggctcgacgacgtcctcatgatcaccgggcgcaacaagcgcccccttgaggaccacttc
gaccgcaactacgagctggaatcggcgctggagaagaagggcgacgccgaacggctcgcg
aaggtgcaggagtccagcgacctggccaccatgcactacgtgcgccagggcgaccccaag
ggcctcgggcacgccgtgctgtgcgccgccccgcacgtcggccacgagcccttcgccgtc
ctcctcggcgacgacctgatcgacccgcgggacccgctgctcgcgcgcatgatcgaggtc
caggagcggcacggcggcagcgtcgtcgccctgatggaggtcgcgcccgagcagatccac
ctctacggctgcgccgcggtggaggccaccgccgacggcgacgtggtcaaggtgacggga
ctggtcgagaagccggacccggcggacgccccctcgaactacgcgatcatcggccgctac
gtcctcgacccgcacgtcttcggcatactgcgcacgaccgagccgggccgcggcggcgag
atccagctcaccgacgcgctccagcagctcgcgcaggacgagaaggtcggcggcccggtg
cacggcgtcgtcttcaagggccgccgctatgacaccggcgaccgtggcgactacctgcgt
gccattgtcagactcgcatgcgaacgtgaggacctgggcccggacttccggacctggctc
cgcagttacgtagccgaggagatgcaggaatcttga

DBGET integrated database retrieval system