KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4698Help
Entry
SHJG_4698         CDS       T02063                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SHJG_4698
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SHJG_4698
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SHJG_4698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5414106..5414612
Genome map
AA seq 168 aa AA seqDB search
MTTTEHSGSPLDVEIGALQGGSADLSRFAGKAVLIVNVASKCGLTPQYTGLEKLQERYAE
QGFTVLGVPCNQFLGQEPGTAEEIAEFCSATYGVTFPLTEKVEVNGAGRHPLYERLVGFA
DAEGHSGDIRWNFEKFLIGRDGQVVARFSPQTEPESAEVVSAIEAQLG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgacgactactgagcacagcggctctccgctggacgtcgagatcggggccctccagggc
ggctccgcggatctgtcgcggttcgcgggcaaggccgtcctcatcgtgaacgtggcctcc
aagtgcgggctgaccccgcagtacaccggactggagaagctccaggagcggtacgccgag
cagggcttcaccgtgctgggcgtgccctgcaaccagttcctcgggcaggagcccggaacc
gccgaggagatcgcggagttctgctcggcgacctacggcgtgaccttcccgctgacggag
aaggtggaggtgaacggggcgggccggcatccgctgtacgagcggctcgtgggcttcgcc
gacgccgaggggcacagcggggacatccgctggaacttcgagaagttcttgatcggccgg
gacggtcaggtcgtcgcgcggttctcgccgcagaccgagccggagtcggccgaggtcgtc
tccgcgatcgaggcccagctcggctga

DBGET integrated database retrieval system