KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_4825Help
Entry
SHJG_4825         CDS       T02063                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SHJG_4825
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_4825
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SHJG_4825
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SHJG_4825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5551504..5552787)
Genome map
AA seq 427 aa AA seqDB search
MAVQTVATTSESTVDLGPAAALSCRECGHRVPLGPVFACEECFGPLEIAYDFSGYDTEEL
RRRIEAGPANIWRYAPLLPVPADVAGKPNINPGWTKLVQADNLARELGVTGGLYVKDDSG
NPTHSFKDRVVAQALEAARAFGFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPHDLEQG
KIVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAEGSKTLAYEI
CEQLGWRLPDQIVVPIASGSQLTKIDKGLQELIKLGLVEDRPYKIFGAQAEGCSPVSTAF
KAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVTDEEVVDAIKLLARTE
GIFAETAGGVTVGVTRKLLEAGVLDPAKTTVVLNTGDGLKTLDAVAGTGLTATIRPTLDS
FREAGLA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcagacagttgccaccaccagcgaatccaccgtcgacctcggccccgccgcg
gccctgagctgtcgcgagtgcggtcaccgggtgccgctcggcccggtcttcgcctgcgag
gagtgcttcggcccgctggagatcgcctacgacttctccggctacgacaccgaggaactg
cgccgccgcatcgaggcgggccccgcgaacatctggcgctacgcgcccctgctgccggta
ccggcggacgtcgccggcaagccgaacatcaacccgggctggaccaagctcgtccaggcc
gacaacctggcccgcgagctgggcgtgaccggcggtctgtacgtgaaggacgactccggc
aacccgacccactccttcaaggaccgggtcgtggcccaggccctggaggccgcccgcgcc
ttcggcttcaccaccctgtcctgctcctcgaccggcaacctggccggcgccgtcggcgcc
gccgccgcccgcgccggcttccgctcctgcgtgttcatcccgcacgacctggagcagggc
aagatcgtgatggccgcggtctacggcggtgaactcgtcggcatcgagggcaactacgac
gacgtgaaccgcttctgctccgagctgatcggcgacccggccggcgagggctggggcttc
gtcaacgtcaacctgcggccgtactacgcggagggctccaagaccctggcgtacgagatc
tgcgagcagctcggctggcggctgccggaccagatcgtggtcccgatcgcctccggctcc
cagctcacgaagatcgacaaggggctccaggagctgatcaagctcggtctggtcgaggac
aggccgtacaagatcttcggcgcccaggccgagggctgctccccggtctccaccgccttc
aaggccggccacgacgtcgtacggccccagaagccgaacaccatcgccaagtccctggcc
atcggcaacccggccgacgggccgtacgtcctggacatcgcgcgccgcaccggcggtgcc
gtggaggacgtgacggacgaggaggtcgtggacgcgatcaagctgctcgcgcggaccgag
ggcatcttcgcggagaccgccggcggcgtgaccgtcggcgtcacccgcaagctgctggag
gcgggcgtgctggacccggcgaagaccacggtcgtcctcaacaccggcgacggcctgaag
accctggacgcggtggccggcaccggcctcaccgccaccatccgcccgaccctggactcc
ttccgagaggctggcctcgcatga

DBGET integrated database retrieval system