KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5071Help
Entry
SHJG_5071         CDS       T02063                                 

Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_5071
  Energy metabolism
   00680 Methane metabolism
    SHJG_5071
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJG_5071
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     SHJG_5071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5811749..5812885)
Genome map
AA seq 378 aa AA seqDB search
MKDVPDAKIEHPCDIIVRITTTNICGSDLHMYEGRTSFESGRTLGHENLGQVVEVGPAVR
KVQVGEYVVLPFNIACGFCKQCEQGLTNYCLTMQPEPALAGAAYGFADMGPYQGGQAELL
RVPYGDFNALRLGEDAAERQTDYVMLADIFPTGYHATEMAHVKPGDQTVVFGAGPVGLMA
TYSALLKGAGRVWTVDHQPDRLRKAEEIGAIPINTAEQDPAEVVKEATLGLGADNGCECV
GYQAHDPQGHEDASLTLNGLIDSVRFTGDIGVVGVFLPQDPGGAEAQGELEAQGKVPIDF
GLMWFKGQHMGTGQAPVKKYNRALRDLIAGGKAKPSFVVSHELSLDEAPTAYEHFDARDE
GWTKVVLHPDGHGNGHKK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtaccggacgcgaagatcgaacacccctgcgacatcatcgtcaggatcacc
accaccaacatctgcggttcggacctgcacatgtacgagggccgcacctcgttcgagtcc
ggccgcaccctgggacacgagaacctgggccaggtggtggaggtcggcccggccgtccgc
aaggtccaggtcggcgagtacgtggtcctgcccttcaacatcgcctgcggcttctgcaag
cagtgcgagcagggcctgaccaactactgcctgaccatgcagccggaaccggccctcgcc
ggagccgcctacggattcgccgacatgggcccctaccagggcggccaggcggaactgctg
cgcgtgccctacggcgacttcaacgcgctgcgtctgggcgaggacgccgccgagcggcag
accgactacgtgatgctcgccgacatctttcccaccggctatcacgccaccgagatggcc
cacgtcaagccgggcgaccagaccgtcgtcttcggggccggtcccgtcgggctgatggcg
acctactccgccctcctcaagggcgccggccgcgtctggacggtcgaccaccagcccgac
cggctgcgcaaggcggaggagatcggggccatcccgatcaacaccgccgagcaggacccc
gcggaggtcgtcaaggaggccaccctcggtctgggcgccgacaacggctgcgagtgcgtc
ggctaccaggcacacgatccccagggacacgaggacgccagcctcacgctcaacggcctg
atcgactcggtccggttcacgggcgacatcggcgtggtgggcgtgttcctgccccaggac
cccggcggcgcggaagcccagggggagctggaggcgcagggcaaggtcccgatcgacttc
ggcttgatgtggttcaagggccagcacatggggaccgggcaggcgccggtgaagaagtac
aaccgggcgctgcgggacctgatcgccggcgggaaggcgaagccgagcttcgtcgtctcc
cacgagctcagcctggacgaggcccccaccgcctacgagcacttcgacgcccgtgacgag
ggctggaccaaggtggtcctgcaccccgacggacatggcaacggccacaaaaagtaa

DBGET integrated database retrieval system