KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5391Help
Entry
SHJG_5391         CDS       T02063                                 

Definition
(GenBank) hydrolase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    SHJG_5391
Enzymes [BR:shy01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SHJG_5391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6168697..6169908
Genome map
AA seq 403 aa AA seqDB search
MSELPLLAKELDQADELAPLRDRFVLDSASGDAAGPAGVYLDGNSLGALPAHVPDRVADV
VRRQWGELRIRSWEESGWWTAPERIGDRIAPLVGAAPGQIVVGDSTSVNVFKALVAAIRM
ADAGRDEILVDATTFPTDGYIAESAARLTGRTLRAVTPAEVPAALGDRTAAVLLNHVDYR
TGRLHDLPALTAAVHACGALAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPA
YLYVRRELQDRFDSPLPGWNSHAEPFGMSPSYAPAAGAVRGRVGTPDILSLLALEAALDV
WDGVSVDAVRAKSLALTDFFLRCVDEYTEPGRVECVTPGPHAERGSQIALRCPDAGEVMK
RLIARGVVGDFRHPDILRFGFTPLYVSFRDAERAARTLGEELA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactgcccctgctcgcgaaggaactggaccaggccgacgaactggcgcccctg
cgcgaccgtttcgtcctcgactccgcgtccggtgacgcggccggccccgcgggcgtctac
ctggacggcaactccctcggcgccctgcccgcgcacgtccccgaccgggtcgcggacgtc
gtccgccgccagtggggcgaactgcgcatccgctcctgggaggagagcggctggtggacg
gcgcccgagcggatcggcgaccggatcgccccgctggtcggcgcggcgcccggccagatc
gtcgtcggcgactcgaccagcgtcaacgtcttcaaggcactggtcgccgcgatccgcatg
gcggacgccggccgcgacgagatcctggtggacgccacgaccttccccaccgacggctac
atcgccgagtcggcggcccggctcaccggccgtaccctgcgcgcggtgaccccggccgag
gtgccggcggcgctgggcgaccgcacggccgccgtgctgctcaaccacgtcgactaccgc
accggccggctgcacgacctcccggcgctcaccgccgcggtgcacgcctgcggggccctc
gcggtctgggacctgtgccacagcgcgggcgcgctgccggtgggcctggacgagcacggc
gtggacctcgcggtcggctgcacctacaagtacctgaacggcggcccgggttcaccggcg
tacctgtacgtgcggcgcgagctccaggaccgcttcgactccccgctgcccggctggaac
tcccacgccgagccgttcggcatgagtccgtcgtacgccccggcggcgggcgcggtgcgc
ggccgggtcggcaccccggacatcctctccctgctggcgctggaggccgccctggacgtc
tgggacggggtgtccgtcgacgccgtccgcgccaagtccctggcgctgacggacttcttc
ctgcggtgcgtggacgagtacaccgagccgggccgggtggagtgcgtgacccccgggccg
cacgcggagcgcggcagccagatcgcgctgcgctgcccggacgcgggcgaggtgatgaag
cgcctgatcgcccggggcgtggtgggagacttccgccaccccgacatcctccgcttcggc
ttcaccccgctgtacgtgagcttccgggacgcggaacgggcggcacggacgctgggggag
gaactggcgtag

DBGET integrated database retrieval system