KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5448Help
Entry
SHJG_5448         CDS       T02063                                 

Definition
(GenBank) putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00620  Pyruvate metabolism
shy00640  Propanoate metabolism
shy00680  Methane metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_5448
   00620 Pyruvate metabolism
    SHJG_5448
   00640 Propanoate metabolism
    SHJG_5448
  Energy metabolism
   00680 Methane metabolism
    SHJG_5448
Enzymes [BR:shy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SHJG_5448
Lipid biosynthesis proteins [BR:shy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SHJG_5448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEY90716
UniProt: H2K9A2
Position
complement(6232656..6234611)
Genome map
AA seq 651 aa AA seqDB search
MSNESLANLLKEERRFAPPADLAAHANVTAEAYEQAKADRLGFWAEQARRLTWAKEPTET
LDWSNPPFAKWFKDGKLNVAYNCVDRHVEAGHGDRVAIHFEGEPGDSRAITYAELKDEVS
RAANALLELGVRKGDRVAIYMPMIPETAIAMLASARIGAAHSVVFGGFSADALATRIQDA
DAKVIITADGGYRRGKPSALKPAVDEAIGKVDNVEHVLVVRRTGQEVAWTEGRDVWWDDI
VARQSAEHTPEAFEAEHPLFILYTSGTTGKPKGILHTSGGYLTQAAYTHWAVFDLKPETD
VYWCTADVGWVTGHSYIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYKVTILYTAPT
AIRTFMKWGDDIPAKFDLSSLRVLGSVGEPINPEAWIWYRKHIGADRTPVVDTWWQTETG
AMMISPLPGVTEAKPGSAQRPLPGISATVVDDEANEVPDGGGGYLVLTEPSPSMLRTIWG
DDQRFIDTYWSRFEDRYFAGDGAKKDEDGDIWLLGRVDDVMLVSGHNISTTEVESALVSH
PSVAEAAVVGATDETTGQAIVAFVILRGTASENEALVGELRDHVGATLGPIAKPKRILPV
AELPKTRSGKIMRRLLRDVAENRQLGDVTTLTDSTVMDLIQAKLPASPSED
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacgagagcctggccaacctgctcaaggaagaacgcaggttcgcgccccccgcc
gacctggcagcacacgccaacgtcaccgcggaggcgtacgaacaggccaaggctgacagg
ctcggcttctgggccgagcaggcccgccggctgacctgggccaaggaaccgaccgagacg
ctggactggtcgaacccgccgttcgcgaagtggttcaaggacggcaagctgaacgtcgcc
tacaactgcgtggaccggcatgtggaggccggccacggggaccgcgtcgccatccacttc
gagggtgagcccggtgacagccgggcgatcacctacgcggagctgaaggacgaggtctcc
cgggccgccaacgccctgctggagctgggcgtgcgcaagggcgaccgcgtcgccatctac
atgccgatgatcccggagaccgcgatcgcgatgctggcctcggcccggatcggcgccgcg
cactcggtcgtcttcggcggcttctcggcggacgcgctcgcgacccggatccaggacgcg
gacgccaaggtgatcatcaccgccgacggcggctaccggcgcggcaagccgtccgcgctc
aagcccgcggtggacgaggcgatcggcaaggtggacaacgtcgagcacgtgctcgtggtc
cgccgcaccggccaggaggtggcctggaccgagggccgggacgtgtggtgggacgacatc
gtcgcccgccagtcggccgagcacacccccgaggcgttcgaggccgagcacccgctgttc
atcctctacacctccggcaccacggggaagccgaagggcatcctgcacacctccggcggc
tacctcacccaggcggcctacacccactgggcggtcttcgacctcaagccggagacggac
gtgtactggtgcacggccgacgtcggctgggtgaccgggcactcgtacatcgtgtacggc
ccgctggccaacggtgcgacgcaggtgatgtacgagggcacgccggacaccccgcaccag
ggccggttctgggagatcgtgcagaagtacaaggtcacgatcctctacacggcgccgacc
gcgatccggacgttcatgaagtggggcgacgacatccccgccaagttcgacctgtcctcc
ctgcgcgtcctcggctcggtgggcgagcccatcaaccccgaggcgtggatctggtaccgc
aagcacatcggcgccgacaggacgccggtcgtggacacctggtggcagaccgagaccggc
gccatgatgatctcgccgctgcccggcgtcaccgaggccaagcccggctccgcgcagcgt
ccgctgcccggcatcagcgcgaccgtcgtcgacgacgaggcgaacgaggtgcccgacggc
ggcggtggctacctggtgctgaccgaaccgtcgccgtcgatgctgcgcaccatctggggc
gacgaccagcggttcatcgacacctactggtcccgcttcgaggacaggtacttcgccggt
gacggcgcgaagaaggacgaggacggggacatctggctgctgggccgggtggacgacgtg
atgctcgtctccgggcacaacatctccaccaccgaggtggagtcggcgctcgtctcgcac
ccgtcggtcgccgaggccgccgtcgtgggcgccaccgacgagaccaccggccaggccatc
gtcgcgttcgtcatcctgcgcggcacggcctcggagaacgaggcgctcgtcggagagctg
cgcgaccacgtcggcgccacgctcggcccgatcgccaagcccaagcggatcctgccggtg
gcggagctgccgaagacccgctccggcaagatcatgcgccgtctactgcgggacgtcgcc
gagaaccgccagctcggtgacgtgaccacgctgacggactccaccgtcatggacctcatc
caggccaagctgcccgcgtcgcccagcgaggactga

DBGET integrated database retrieval system