KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5536Help
Entry
SHJG_5536         CDS       T02063                                 

Definition
hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJG_5536
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SHJG_5536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6325230..6325841)
Genome map
AA seq 203 aa AA seqDB search
MTRPFHQGHSDPTVQPVPASVVEQVDAADTTLSNPKWAVISIGSNLGNRLETLQGAVDAL
EDTPGVRVKAVSPVYETEPWGVEPGSQPSYFNAVVVLKTTLPPSSLLERAHAVEEAFHRV
RDERWGARTLDVDIVAYAGVTSDDPRLTLPHPRAHERAFVLAPWHDVDPQAQLPGRGTVA
DLLSAVTREGVAPRADLELRLPE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacctttccaccagggtcacagcgacccgaccgtccagccggtgcccgcctcg
gtcgtcgagcaggtcgacgccgccgacacgacgctgagcaacccgaagtgggccgtgatc
tccatcggctccaacctcggcaaccgcctggagaccctccagggagccgtcgacgccctg
gaggacaccccgggcgtccgggtgaaggccgtctccccggtgtacgagaccgagccgtgg
ggcgtggagccgggcagccagccgtcgtacttcaacgcggtcgtggtcctcaagacgacc
ctgcccccgtcgtccctgctggagcgggcgcacgccgtcgaggaggccttccaccgcgtc
cgggacgagcgctggggcgcgcgcacgctggacgtcgacatcgtcgcctacgccggcgtc
acctcggacgacccgcggctcaccctgccccacccgcgcgcccacgagcgcgccttcgtg
ctcgcgccctggcacgacgtcgacccgcaggcgcagctccccggccgcggcacggtggcc
gacctgctgtccgccgtcacccgtgagggtgtcgcgccccgcgcggacctggaactccgg
ctgcccgagtag

DBGET integrated database retrieval system