KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5539Help
Entry
SHJG_5539         CDS       T02063                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6326957..6327808)
Genome map
AA seq 283 aa AA seqDB search
MGVVNVTPDSFSDGGRWFDTTVAVKHGLDLVAQGADLVDVGGESTRPGATRVDEAEELRR
VIPVVRGLASEGVVVSVDTMRASVAERALAAGAALVNDVSGGLADPAMIPVVADAGAPFV
VMHWRGFLQGGNVKGVYEDVVGEVVDELHARVEAVLAGGIAPDHIVVDPGLGFSKEAEHD
LALLARLDRLASLGHPLLVAASRKRFLGRVLAGPQGAPPPARERDAATAAVSALAAHAGA
WAVRVHEVRATADAVRVARAVEEARGAAGAPGAGGEHGAEGER
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcgtgaacgtgacccccgactccttctccgacggcggccgctggttcgacacg
accgtcgccgtcaagcacggcctggatctggtcgcccagggcgcggatctggtcgacgtc
ggcggcgagtccacccggcccggggccacgcgcgtggacgaggcggaggagctgcggcgg
gtcatccccgtggtgcggggcctcgcctccgagggcgtcgtcgtctccgtcgacaccatg
cgcgcctccgtcgccgaacgggccctcgcggcaggcgccgccctcgtcaacgacgtcagc
ggcggcctcgccgatcccgcgatgatcccggtggtcgccgacgcgggcgcccccttcgtc
gtcatgcactggcgcggcttcctccagggcggcaacgtcaagggcgtctacgaggacgtc
gtcggggaagtcgtggacgaactgcacgcgcgcgtggaggccgttctggcgggcggtatc
gccccggaccacatcgtcgtcgacccgggcctcggcttctccaaggaggccgagcacgac
ctcgccctcctcgcccgcctcgaccggctggcctccctcgggcacccgctgctggtcgcc
gcctcccgcaagcggttcctcggccgggtcctcgccggaccgcagggggcgcccccgccg
gcccgggagcgcgacgcggccacggcagccgtctccgcgctcgccgcgcacgccggcgcg
tgggcggtgcgcgtgcacgaggtgcgcgccacggcggacgcggtccgggtggcccgggcc
gtggaggaggctcgcggcgcggcgggcgcgcccggcgccggcggcgagcacggggcggaa
ggagagcggtga

DBGET integrated database retrieval system