KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5609Help
Entry
SHJG_5609         CDS       T02063                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJG_5609
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SHJG_5609
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJG_5609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6406188..6407198
Genome map
AA seq 336 aa AA seqDB search
MTKYGSFPGTRPRRLRTTPVMRRMVAETRLHPADFILPAFIREGVSEPVPVAAMPGVVQH
TRDSLKKAALEAVEAGISGIMLFGVPEEAKKDAQGTVGTDPDGILQVALRDVRAEVGDDL
LVMSDLCLDEFTDHGHCGVLDAEGRVDNDATLERYAEMAQVQADAGAHVVGPSGMMDGQI
GVVRDALDQIGREDVAILAYTAKYSSAFYGPFREAVASSLQGDRKTYQQDPANWRESLRE
LELDLTEGADMVMVKPAGPYLDILARVADAVDVPVAAYQISGEYSMIEAAAEKGWIDRDR
AIFETLTGIKRAGARNILTYWATEVAQKLSRSPFTS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtacggttccttccccggtacgcgtccccgacggttgcgcaccacccccgtc
atgcgccgcatggtcgccgagacccggctgcaccccgccgacttcatcctcccggcgttc
atccgggagggcgtcagcgagccggtgccggtcgccgcgatgcccggcgtcgtgcagcac
acccgggacagtctgaagaaggccgcgctggaggccgtggaggccgggatctccgggatc
atgctgttcggcgtgccggaggaggccaagaaggacgcccagggcaccgtcggcaccgat
ccggacgggatcctccaggtcgccctccgggacgtgcgggccgaggtcggcgacgacctg
ctcgtcatgtccgacctgtgcctggacgagttcaccgaccacgggcactgcggggtgctg
gacgccgaggggcgcgtcgacaacgacgccaccctggagcggtacgccgagatggcccag
gtgcaggccgacgccggcgcccatgtcgtcggccccagcgggatgatggacggccagatc
ggcgtcgtccgggacgcgctggaccagatcggccgcgaggacgtcgcgatcctcgcctac
accgccaagtactcctcggccttctacggccccttccgcgaggccgtcgcctcctcgctc
cagggcgaccgcaagacctaccagcaggatccggccaactggcgcgagtccctgcgggaa
ctggagctggacctcaccgagggcgccgacatggtgatggtcaagccggccggcccctac
ctcgacatcctcgcccgggtcgcggacgccgtggacgtgcctgtcgccgcctaccagatc
tccggcgagtactcgatgatcgaggccgccgccgagaagggctggatcgaccgggaccgg
gcgatcttcgagaccctgaccggcatcaagcgggccggggcgcgcaacatcctcacctac
tgggccaccgaggtggcccagaagctgagccgttccccgttcaccagttga

DBGET integrated database retrieval system