KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5880Help
Entry
SHJG_5880         CDS       T02063                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SHJG_5880
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SHJG_5880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6691163..6692941
Genome map
AA seq 592 aa AA seqDB search
MPQDAYDYDVLIVGSGFGGSVSALRLTEKGYKVGVLEAGRRFTRATLPKNSWDLKNYLWA
PRLGMFGIQRIHLLGNVMVLAGAGVGGGSLNYANTLYVPPKPFFEDPQWRHITDWQEELG
PYYDQARRMLGVRLNPTMTPSDVHLKAAAERMGVGDTFHLAPVGVFFGDGEDADGKAKAR
PGERVSDPYFGGAGPDRRACTECGECMTGCRHGAKNTLNENYLYLAEKAGAVVHPMTTVV
SVTDDSRGGYAVATLPTDRKKTGEGRLFTARKVVLAAGTYGTQTLLHRMKAGGQLPYLSA
RLGDLTRTNSEALVGAQTDNRRYRRATGAPRADFTRGVAITSSIHPDENTHIEPVRYGKG
SNSMGGLSILQVPYAEGSSRVLAWLANAARHPMLVARSLSNRRWSERTIIGLVMQSLDNS
LTTYLKPGGIGRGLLTARQGHGAPNPKQIRAATEAASALAAEINGFAGSNVGELMGTPLT
AHFLGGCPIGDSPETGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTITAQAERAMSF
WPNKGEEDPRPAPGAAYERLKPVEPQTPAVPADAFGALRLPFLGMPAVPPKK
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcaagacgcctacgactacgacgtcctgatcgtcggctccggcttcggcggctcg
gtgtccgccctccggctcaccgagaaggggtacaaggtcggggtactggaagccggacgc
cgcttcacccgcgccacgctgccgaagaactcctgggacctgaagaactacctctgggcc
ccgaggctcggcatgttcggcatccagcgcatccacctgctgggcaatgtgatggtgctg
gccggcgcgggcgtcggcggcggctccctcaactacgccaacaccctctacgtgccgccg
aagcccttcttcgaggacccccagtggcggcacatcaccgactggcaggaggagctgggg
ccgtactacgaccaggcccggcgcatgctcggggtgcggctcaaccccaccatgaccccc
tccgacgtccacctgaaggcggcggccgagcggatgggcgtcggcgacaccttccacctg
gccccggtgggcgtgttcttcggtgacggcgaggacgccgacggcaaggcgaaggcccgg
cccggcgagcgggtgagcgacccgtacttcggcggggccggccccgaccggagggcctgc
accgagtgcggcgagtgcatgaccggctgccggcacggcgcgaagaacaccctcaacgag
aactacctgtacctcgccgagaaggccggcgccgtcgtgcaccccatgacgacggtcgtg
tccgtcacggacgactcgcgcggcggctacgcggtggcgaccctgccgacggaccggaag
aagacgggcgagggccggctcttcaccgcccgcaaggtggtcctcgcggccggcacctac
ggcacccagaccctgctgcaccgcatgaaggccggaggccagctgccctacctgtccgcc
cggctcggcgacctgacccgcaccaactccgaggccctggtcggcgcgcagaccgacaac
cgccgctaccgcagggccaccggcgcgccgcgggccgacttcacgcggggcgtcgccatc
acgtcctcgatccaccccgacgagaacacccacatcgaacccgtccggtacggcaagggc
tccaactcgatgggcggcctgtccatcctccaggtgccctacgccgagggctcctcgcgc
gtcctcgcctggctggcgaacgcggcccggcacccgatgctggtcgcccgctccctgtcc
aaccggcgctggtcggagcggaccatcatcggcctggtcatgcagtccctggacaactcg
ctgaccacgtacctcaagcccggcggcatcggcaggggcctgctcaccgcgcggcaggga
cacggcgcgccgaaccccaagcagatcagggccgcgaccgaggccgcctccgcgctcgcc
gccgagatcaacggcttcgccggcagcaacgtcggcgagctgatgggcaccccgctcacc
gcgcacttcctcggcggctgccccatcggcgactccccggagacgggcgtgatcgacccg
taccaccggctctacggccaccccggcatctcggtcgtggacggcgccgcggtctcggcg
aacctgggggtgaacccctcgctgacgatcaccgcacaggccgagcgggcgatgtccttc
tggccgaacaagggcgaggaggacccgcggccggcacccggagcggcgtacgagcggctg
aagccggtggagccgcagaccccggcggtcccggcggacgcgttcggcgcgctgcggctg
ccgttcctggggatgccggcggtaccgccgaagaagtga

DBGET integrated database retrieval system