KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5910Help
Entry
SHJG_5910         CDS       T02063                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_5910
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SHJG_5910
   00640 Propanoate metabolism
    SHJG_5910
   00660 C5-Branched dibasic acid metabolism
    SHJG_5910
Enzymes [BR:shy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SHJG_5910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6726774..6727952
Genome map
AA seq 392 aa AA seqDB search
MDLFEYQARDLFAKHDVPVLAGEVIDTPEAAREITERLGGKSVVKAQVKVGGRGKAGGVK
LAASPDEAVARATDILGMDIKGHTVHKVMIAETAPEIVEEYYVSFLLDRANRTFLSIASV
EGGMEIEEVAATRPEAVAKTPIDPIDGVDEAKAREIVEAAKFPAEVADKVVNVLIKLWDT
FLKSDALLVEVNPLAKVASGEVIALDGKVSLDDNAEFRHPEYEALHDKAAANPLEAAAKE
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAQVMANGL
EIILGDPDVKSVFVNVFGGITACDEVANGIVQALKLLEDRGEKVEKPLVVRLDGNNAELG
RKILTDANHPLVQRVDTMDGAADKAAELAAAK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacgatgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcggcgcgcgagatcaccgagcggctcggcggc
aagtccgtcgtcaaggcgcaggtgaaggtcggtggtcgcggcaaggccggcggcgtcaag
ctggccgcctccccggacgaggccgtcgcccgcgcgacggacatcctcggcatggacatc
aagggccacacggtccacaaggtcatgatcgccgagaccgctccggagatcgtcgaggag
tactacgtctccttcctcctcgaccgtgccaaccgcaccttcctgtccatcgcgtccgtc
gagggcggcatggagatcgaggaggtggcggccacccgtccggaggccgtcgccaagacc
ccgatcgacccgatcgacggtgtggacgaggccaaggcccgcgagatcgtggaggccgcc
aagttcccggccgaggtcgcggacaaggtcgtcaacgtcctgatcaagctgtgggacacc
ttcctcaagtcggacgccctcctcgtcgaggtcaacccgctcgcgaaggtcgcctccggt
gaggtcatcgcgctcgacggcaaggtgtcgctcgacgacaacgccgagttccgtcacccc
gagtacgaggcgctccacgacaaggccgcggccaacccgctggaggccgccgccaaggag
aagaacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgccggt
ctcgtcatgagcaccctggacgtcgtcgcgtacgccggtgagaagcacggtggcgtcaag
cccgccaacttcctggacatcggcggcggtgcctccgcccaggtgatggcgaacggcctg
gagatcatcctgggcgacccggacgtcaagtccgtcttcgtgaacgtcttcggtggcatc
accgcctgcgacgaggtcgccaacggcatcgtgcaggccctgaagctcctggaggaccgc
ggcgagaaggtcgagaagccgctcgtcgtccgcctcgacggcaacaacgccgagctgggc
cggaagatcctcacggacgccaaccacccgctggtgcagcgcgtcgacaccatggacggc
gcggccgacaaggccgccgagctggccgccgccaagtaa

DBGET integrated database retrieval system