KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_5983Help
Entry
SHJG_5983         CDS       T02063                                 

Definition
secreted hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SHJG_5983
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SHJG_5983
Enzymes [BR:shy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SHJG_5983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6823529..6824863
Genome map
AA seq 444 aa AA seqDB search
MVVSDPELADEGRLVAGELGLRYAGEKDDVRAGDVRLALGGGDGNEESYTMTVRGGRVDI
SGPGEAGVFYGTRTLKQEVHGGGTAPEGVVRDEPAKPVRGFMLDIARKPYDETWIEDRIR
ELGDLKFNELGLHFSDDQAFRIESDSHPEIVSKDHLTKAQVRRIVALADSRHITVVPEID
SPGHLGAVIAAHPDLQLRNAGGVPTRGAVDISEDASARIVDDLLDEYAELFTGGQWHLGG
DEYQALTVRDPQASYPQLAAAARRAFGAGATVADLATGWLGDRAATVRAHDRTVRAWNDG
FYRGTSVRPDPDIQVAYWTGKEIGARQPVEYLSAGRKVLNYNDEFLYYVLGQPQTFVYPT
GQRIYEQWNPRVLRGTTAVPERYDAQILGGSFAVWSDFPNAQTQAQVAAGIRMPLRATAQ
KLWDPGTPALSWADFRGLADRLDR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtgagcgacccggagctggccgacgaggggcggctcgtcgccggggaactggga
ctgcgctacgcgggggagaaggacgacgtgcgggcgggcgacgtacggctggcgctcggc
ggcggggacgggaacgaggagtcgtacaccatgaccgtccgcggcgggcgggtcgacatc
agcggacccggcgaggccggcgtcttctacggcacccgcaccctgaagcaggaggtccac
ggcggcggtacggcacccgagggcgtcgtacgggacgagcccgccaagccggtgcgcggg
ttcatgctggacatcgcgcgcaagccgtacgacgagacctggatcgaggaccggatacgc
gagctgggggacctgaagttcaacgagctgggcctgcacttctccgacgaccaggccttc
cggatcgagtccgacagccaccccgagatcgtctccaaggaccacctgaccaaggcccag
gtcaggaggatcgtcgcgctggcggacagccggcacatcaccgtcgtccccgagatcgac
tcgccggggcacctgggcgccgtcatcgccgcccacccggacctccagctgcgcaacgcc
ggtggcgtgccgacgcggggtgccgtcgacatctccgaggacgcctccgcgaggatcgtc
gacgacctgctcgacgagtacgccgagctgttcaccggcggccagtggcacctgggcggg
gacgagtaccaggcgctgaccgtcagggacccgcaggcctcgtacccgcaactggccgcc
gccgcccggcgggccttcggcgccggcgcgaccgtcgccgacctcgccaccggctggctg
ggcgaccgcgccgccaccgtccgcgcccacgaccggaccgtccgcgcctggaacgacggc
ttctaccgcggtacctccgtgcggcccgacccggacatccaggtcgcctactggaccggc
aaggagatcggcgcccgccagcccgtggagtacctgagcgcggggcggaaggtgctcaac
tacaacgacgagttcctctactacgtgctcgggcagccgcagaccttcgtctacccgacc
ggacagcggatctacgagcagtggaacccgcgcgtgctgcgcggcacgaccgccgtgccg
gagcgctacgacgcgcagatcctcggcggctccttcgcggtctggtccgacttcccgaac
gcgcagacgcaggcacaggtcgccgccggcatccggatgccgctgcgggccaccgcgcag
aagctgtgggacccgggcacgcccgcgctgtcctgggccgacttccgcgggctggcggac
cggctggaccggtaa

DBGET integrated database retrieval system