KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6151Help
Entry
SHJG_6151         CDS       T02063                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:shy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shy00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shy00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7000918..7001664
Genome map
AA seq 248 aa AA seqDB search
MQIFGVDIGGSGIKGAPVDLDRGDLAQERCKVLTPHPATPDGVADGVKQVVDHFGWTGPV
GLTFPGVITGGATVRTAANVDKSWIDTDARALFSGRLGGLPVTVVNDADAAGVAEMEFGA
GRSRKGTVILLTFGTGIGSAVFVDGVLLPNTELGHLELDGHDAEKRASSKVKEDHDLSWE
QWAHRVQKYLAHVEMLFSPELFIIGGGVSRKANKFLHLIEGVKAEIVPAQLENNAGIVGA
AMRAAQRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcggcgtggacatcggcggatccggcatcaagggcgccccagtggatctg
gaccggggcgacctggcccaggagcgctgcaaggtgctcaccccgcacccggcgacgccc
gacggcgtggcggacggggtcaaacaggtggtggaccacttcgggtggacgggcccggtc
ggcctgaccttccccggcgtgatcaccggcggcgccacggtccgtacggcggcgaacgtc
gacaagagctggatcgacacggacgcgcgcgcgttgttcagcggccggctcggcggcctg
ccggtgaccgtggtcaacgacgcggacgcggcgggcgtcgccgagatggagttcggcgcc
ggccggagccgcaagggcacggtcatcctgctcaccttcggcacgggcatcggaagcgcc
gtcttcgtggacggcgtcctgctgcccaacaccgagctgggccacctggagctggacggc
cacgacgccgagaagcgcgcctccagcaaggtcaaggaggaccacgacctcagctgggag
cagtgggcgcaccgcgtccagaagtacctggcccacgtggagatgctgttctcgccggag
ctgttcatcatcggcggcggggtcagccgcaaggcgaacaagttcctgcacctcatcgag
ggcgtcaaggccgagatcgtgcccgcccagctggagaacaacgcggggatcgtgggcgcg
gcgatgagagcggcccagcgcgcctag

DBGET integrated database retrieval system