KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6151Help
Entry
SHJG_6151         CDS       T02063                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
shy00010  Glycolysis / Gluconeogenesis
shy00520  Amino sugar and nucleotide sugar metabolism
shy01100  Metabolic pathways
shy01110  Biosynthesis of secondary metabolites
shy01120  Microbial metabolism in diverse environments
shy01130  Biosynthesis of antibiotics
shy01200  Carbon metabolism
Module
shy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_6151
   00520 Amino sugar and nucleotide sugar metabolism
    SHJG_6151
Enzymes [BR:shy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SHJG_6151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEY91418
UniProt: H2JYW8
Position
7000918..7001664
Genome map
AA seq 248 aa AA seqDB search
MQIFGVDIGGSGIKGAPVDLDRGDLAQERCKVLTPHPATPDGVADGVKQVVDHFGWTGPV
GLTFPGVITGGATVRTAANVDKSWIDTDARALFSGRLGGLPVTVVNDADAAGVAEMEFGA
GRSRKGTVILLTFGTGIGSAVFVDGVLLPNTELGHLELDGHDAEKRASSKVKEDHDLSWE
QWAHRVQKYLAHVEMLFSPELFIIGGGVSRKANKFLHLIEGVKAEIVPAQLENNAGIVGA
AMRAAQRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcggcgtggacatcggcggatccggcatcaagggcgccccagtggatctg
gaccggggcgacctggcccaggagcgctgcaaggtgctcaccccgcacccggcgacgccc
gacggcgtggcggacggggtcaaacaggtggtggaccacttcgggtggacgggcccggtc
ggcctgaccttccccggcgtgatcaccggcggcgccacggtccgtacggcggcgaacgtc
gacaagagctggatcgacacggacgcgcgcgcgttgttcagcggccggctcggcggcctg
ccggtgaccgtggtcaacgacgcggacgcggcgggcgtcgccgagatggagttcggcgcc
ggccggagccgcaagggcacggtcatcctgctcaccttcggcacgggcatcggaagcgcc
gtcttcgtggacggcgtcctgctgcccaacaccgagctgggccacctggagctggacggc
cacgacgccgagaagcgcgcctccagcaaggtcaaggaggaccacgacctcagctgggag
cagtgggcgcaccgcgtccagaagtacctggcccacgtggagatgctgttctcgccggag
ctgttcatcatcggcggcggggtcagccgcaaggcgaacaagttcctgcacctcatcgag
ggcgtcaaggccgagatcgtgcccgcccagctggagaacaacgcggggatcgtgggcgcg
gcgatgagagcggcccagcgcgcctag

DBGET integrated database retrieval system