KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6164Help
Entry
SHJG_6164         CDS       T02063                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    SHJG_6164
Enzymes [BR:shy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     SHJG_6164
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     SHJG_6164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7010708..7011436
Genome map
AA seq 242 aa AA seqDB search
MTAAPTSGFSAFALEPFPELQPGDDLAGTITGVLNRTGTKLRDGDIIVVASKAVSVGEKR
YVDLADVTPGPEALALSAKTGKPAEIVQLILDSSTEHFLATEKGPIIARHTLGYQLTSAG
IDRAGTEGAWLLPADPDASARSLRDALSTYSGATIAVVIADSDGHADRRGATVISIGAAG
VAPLRVTEHGGKRQEESFTDLIAAAAGIILGQRGRGAPVAVLRGIAYETSDEGVAAMLHH
QP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgccccgacctcaggcttctccgccttcgccttggagcccttccccgaactc
cagccgggcgacgatctcgccggcaccatcaccggtgtcctcaaccgcaccggcaccaag
ctgcgcgacggggacatcatcgtcgtcgccagcaaggccgtgtccgtgggggagaagcgg
tacgtcgacctggccgacgtcacccccggccccgaggccctcgctctgtccgccaagact
ggcaagccagccgagatcgtgcaactgatcctcgactcctccaccgagcacttcctggcc
accgaaaaggggccgatcatcgctcgccacacgctcggctaccagctcacctccgccggg
atcgaccgggccggcaccgaaggcgcctggctactgcccgcagaccctgacgcttccgcc
cgctccctgcgcgacgccctgagcacatactccggcgccaccatcgccgtggtcatcgcc
gactccgacggccacgccgaccggcgcggcgccaccgtcatctccatcggagcggcaggc
gtggcgcccctgcgggtgacggagcacggcggcaagcggcaggaggagagcttcaccgac
ctcatcgccgcggcagctggcatcatcctcggccagcgcggccgtggcgcaccggtcgcg
gtcctgcgcggcatcgcgtacgagaccagtgacgagggggtggccgcgatgctccaccac
cagccgtga

DBGET integrated database retrieval system