KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6239Help
Entry
SHJG_6239         CDS       T02063                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SHJG_6239
  Amino acid metabolism
   00300 Lysine biosynthesis
    SHJG_6239
Enzymes [BR:shy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SHJG_6239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7102245..7103330
Genome map
AA seq 361 aa AA seqDB search
MAMADTSLDLTLDAAALTAQLVDFPSESGTEKPLADAIEAALRGLPHLTVDRYGNNVIAR
TDLGRAERVILAGHIDTVPIADNVPSRLDADGVLWGCGTCDMKSGVAVQLRIAATVPAPN
RDLTFVFYDNEEVAADLNGLGHVAEAHPDWLAGDFAVLLEPSDGEVEGGCQGTLRVLLRT
KGERAHSARAWMGSNAIHAAAPVLARLASYEPRRPVIDGLEYREGLNAVGISGGVAGNVI
PDECVVTVNFRYAPDRTEQEAVAHVQEVFADCGVEEFVVDDHSPGALPGLSQPAAAAFIE
AVGGTPRPKYGWTDVSRFSALGIPAVNYGPGNPHLAHKRDERVETAKILAGEERLRNWLT
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggccatggccgacacctcgcttgacctcacgctggacgccgccgcgctcaccgcgcag
ctcgtggacttcccctccgagagcggcaccgagaagccgctcgcggacgccatcgaggcc
gcgctgcgcggcctgccgcacctgacggtggaccgctacggcaacaacgtgatcgcccgg
acggacctgggccgcgccgagcgcgtcatcctggccgggcacatcgacaccgtgccgatc
gcggacaacgtgccctcgcggctcgacgcggacggggtgctgtggggctgcggcacgtgt
gacatgaagtcgggcgtggcggtgcagctgcgcatcgcggccaccgtccccgcccccaac
cgcgacctgaccttcgtcttctacgacaacgaggaggtcgccgccgacctcaacggcctg
gggcacgtcgccgaggcccacccggattggctggcgggcgacttcgcggtcctgctggag
ccctccgacggcgaggtggagggcggctgccagggcacgctgcgggtgctgctgaggacg
aagggcgagcgggcccactcggcgcgcgcctggatgggctccaacgcgatccacgcggcg
gcccccgtcctggcccggctggcctcctacgagccgcgccggccggtcatcgacgggctg
gagtaccgcgagggcctgaacgcggtgggcatcagcgggggagtggccgggaacgtcatc
ccggacgagtgcgtggtcacggtcaacttccggtacgcccccgaccgcaccgagcaggag
gccgtcgcgcacgtccaggaggtgttcgcggactgcggcgtggaggagttcgtggtggac
gaccacagccccggcgcgctgcccggcctctcccagccggccgccgccgccttcatcgag
gcggtgggcggcaccccgcggcccaagtacggctggacggacgtctcccgcttctccgcg
ctcggcatccccgcggtcaactacggccccggcaacccgcacctggcgcacaagcgggac
gagcgcgtggagaccgcgaagatcctggccggcgaggaacgactgcggaactggctcacc
gcctag

DBGET integrated database retrieval system