KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6436Help
Entry
SHJG_6436         CDS       T02063                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SHJG_6436
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SHJG_6436
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SHJG_6436
Enzymes [BR:shy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SHJG_6436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7325816..7326874
Genome map
AA seq 352 aa AA seqDB search
MTHQWRGIIEEYRDRLPVSDTTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAISKAKEEGAKAVICASTGNTSASAAAYAVRAGMVSAVLVPQGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARALSENYPVALVNSVNPVRIEGQKTAAFEIVDMLGDAP
DIHVLPVGNAGNITAYWKGYKEYAADGVSGGTPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWSHALAARDESGGAIDEVTDREILRAYRLLAAQEGVFVEPASAASVAGLLK
AAEQGKVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggacaggctgccggtgtccgac
accacgccggtcgtgacgctccgtgagggcggcacgcccctcgtgcccgcgcaggtgctc
tccgagcgcacgggctgcgaggtccacctgaaggtggagggggccaaccccaccgggtcc
ttcaaggaccgcggtatgaccatggccatcagcaaggccaaggaggagggggcgaaggcc
gtcatctgcgcctccacgggcaacacgtccgcctccgccgccgcgtacgccgtgcgggcc
ggcatggtctccgccgtgctcgtgccgcagggcaagatcgccctcggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgacggcaacttcgacgactgcctcacc
ctggcgcgggcactgagcgagaactaccccgtggcgctggtgaattcggtcaacccggtg
cgcatcgagggccagaagacggctgccttcgagatcgtggacatgctcggcgacgcgccc
gacatccacgtcctgccggtcggcaacgcgggcaacatcacggcctactggaagggttac
aaggagtacgccgccgacggcgtctccggcgggaccccccgcatgtggggtttccaggcg
tccggcagtgccccgatcgtgcggggcgaggtcgtcaaggacccgtcgaccatcgccacc
gccatccgcatcggcaaccccgcgtcctggagccacgccctggccgcgcgggacgagtcc
ggcggcgccatcgacgaggtgacggaccgtgagatcctgcgcgcctaccgcctgttggcc
gcgcaggagggcgtcttcgtggagcccgcctccgccgcctccgtggccggtctgctcaag
gccgccgagcagggcaaggtggacccgggccagcgcatcgtgtgcaccgtcaccggcaac
ggcctgaaggaccccgactgggccgtcgccggcgccccgcagccggtcaccgtcccggtc
gacgcggccaccgcggccgagcgcctcggcctggcctga

DBGET integrated database retrieval system