KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_6690Help
Entry
SHJG_6690         CDS       T02063                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:shy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7609958..7610818
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEVVRRGLERWVAHRTVAETEVLHPRAVRRHVAGADDFAHRLKGHHIGTPRRRG
KYLWLPLEETNQSVLAHLGMSGQLLVQPHETADEKHLRIRVRFADSLGTELRFVDQRTFG
GLSLHDNTPDGLPDVIAHIARDPLDPLFDDEAFHQALRRKRTTIKRALLDQSLISGVGNI
YADEALWRARIHYERPTANFTRPVTAELLGHIRDVMNAALAVGGTSFDSLYVNVNGESGY
FDRSLDAYGREGEPCRRCGTPMRRRPWMNRSSYFCPTCQRAPRVSS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagttgcccgaggtcgaagtcgtccgccggggcctggagcgctgggtcgcccac
cggaccgtcgccgagaccgaggtgctgcacccgcgagccgtacgccggcacgtcgccggg
gccgacgacttcgcgcaccggctcaagggccaccacatcggcacgccccggcggcgcggc
aagtacctgtggctgccgctggaggagacgaaccagtccgtcctcgcccacctcggcatg
agcggacagctactggtccagccgcacgagacggcggacgagaagcacctgcgcatccgc
gtgcggttcgccgactccctaggcaccgaactccgcttcgtcgaccagcgcaccttcggc
gggctgtcgttgcacgacaacacccccgacggcctgcccgacgtcatcgcgcacatcgcc
cgcgacccgctggacccgctcttcgacgacgaggccttccaccaggcgctgcgccgcaag
cggaccaccatcaagcgggccctgctggaccagtcgctgatcagcggcgtcggcaacatc
tacgcggacgaggccctgtggcgcgcccgcatccactacgaacgccccacggcgaacttc
acccgcccggtcacggcggaactcctcggtcacatccgggacgtgatgaacgcggccctc
gccgtcggcggcaccagcttcgacagcctgtacgtcaacgtcaacggcgaatccggctac
ttcgaccgttccctggacgcctacggccgggagggcgagccctgccgccgctgcggcacc
cccatgcgccggcgcccctggatgaaccggtccagctacttctgccccacgtgtcagagg
gcgccgcgcgtctcgtcgtaa

DBGET integrated database retrieval system