KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7101Help
Entry
SHJG_7101         CDS       T02063                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SHJG_7101
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SHJG_7101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8111523..8112878
Genome map
AA seq 451 aa AA seqDB search
MTVLEAGDRVGGKLLPGEIAGVRVDLGAESMLARRPEAVALAREAGLGELLQPPATATAS
IWTRGALRPMPKGHVMGVPGTAAALAGVLSDEGLARIERDADLPRTEVGDDVAVGEYVAA
RLGREVVDRLVEPLLGGVYAGDAYRISMRSAVPQLFQAARTHASLTEGVREIQVKAAAQQ
QTGPVFMGIAGGVGRLPQAVADSVRARGGEILTGTPARELRREAAGGWRITAGERVLRAD
AVIVAVPAPAAAALLRAESPGAAAELDAVEYASMALITLAYRHADLNLPAGSGFLVPPVD
GRTIKASTFASQKWGWIAEEDPDVVVLRTSVGRHGETEVLGRDDADLVEVSRHDLREATG
LAAAPLRTRVTRWTDGLPQYPVGHHARVARVREQIAKLPGLAVCGAQYDGVGIPACIASA
YAAVDQLGGDLTGVRELTANPVQSLHGGAGE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgctggaggccggcgaccgggtcggcggcaagctgttgcccggcgagatcgcc
ggcgtgcgcgtcgacctgggcgccgagtccatgctcgcccgccgccccgaagcggtggcc
ctcgcgcgcgaggccggactcggcgagctgctccagccgcccgccaccgcgaccgcctcg
atctggacccggggcgccctgcggcccatgcccaagggccatgtgatgggcgtgcccggc
accgccgccgccctggccggcgtcctgtcggacgagggcctggcccgcatcgagcgcgac
gccgacctgccccgcaccgaggtcggcgacgacgtggccgtgggggagtacgtggcggcc
cggctcggccgcgaagtcgtcgaccggctcgtcgaacccctgctcggcggggtgtacgcg
ggcgacgcctaccgcatctcgatgcgctccgccgtcccccagctcttccaggccgcccgc
acccacgcctccctcacggagggcgtccgggagatccaggtgaaggccgccgcccagcag
cagaccgggccggtcttcatgggcatcgccggtggggtcggccggctgccgcaggcggtc
gccgactcggtgcgcgcgcggggcggcgagatcctgaccggcacgcccgcgcgtgaactg
cgccgcgaggcggccggcggctggcggatcaccgccggggagcgcgtgctgcgcgccgac
gccgtgatcgtcgccgtacccgccccggccgccgccgccctgctgcgcgccgagtccccg
ggggccgccgccgagctggacgccgtcgagtacgcctcgatggccctgatcaccctcgcc
taccggcacgccgacctgaacctgcccgcgggcagcggcttcctggtgccgcccgtcgac
ggccgcaccatcaaggcctccaccttcgcctcccagaagtggggctggatcgccgaggag
gacccggacgtggtcgtcctgcgcacgtccgtgggccgccacggcgagacggaggtcctc
ggccgggacgacgccgacctggtggaggtctcccggcacgacctgcgggaggccaccggc
ctggccgccgcacccctgcggacccgggtcacccgctggaccgacggcctgccgcagtac
ccggtcgggcaccacgcgcgcgtggcccgcgtccgcgagcagatcgccaagctgccgggg
ctcgcggtgtgcggcgcgcagtacgacggcgtcggcatcccggcctgcatcgcgagcgcg
tacgcggcggtggaccagctcggcggcgacctcaccggggtccgggagctcacggccaac
ccggtgcagagcctgcacggcggagcgggagaatag

DBGET integrated database retrieval system