KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7257Help
Entry
SHJG_7257         CDS       T02063                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_7257
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJG_7257
   00620 Pyruvate metabolism
    SHJG_7257
   00640 Propanoate metabolism
    SHJG_7257
  Energy metabolism
   00680 Methane metabolism
    SHJG_7257
Enzymes [BR:shy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SHJG_7257
Lipid biosynthesis proteins [BR:shy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SHJG_7257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8282279..8283952
Genome map
AA seq 557 aa AA seqDB search
MTTATEMFRRARDFLLEHREDYATAYEGFRWPRPEHFNWALDWFDEIADGNDRTALHIVE
EDGSETRLSFAELSERSDRVARWLRERGVAAEDRVLVMLGNQAELWETALAAMKLRAVVI
PATPLLGPADLADRVERGRVKHVVVRAEDTAKFADVPGAYTRISVGGLPQEGWEPYEDAY
AVPAEFVPDGPTLADDPLMLYFTSGTTARPKLVEHTHTSYPVGHLATMYWIGLKPGDVHL
NISSPGWAKHAWSNLFAPWNAEATVFVFNYTRFDAARLMAEMDRAGVTTFCAPPTVWRML
IQADLGQLRTPPREIVAAGEPLNPEVIEQVRRAWGVAVRDGFGQTETAVQVSNSPGQPLK
TGSMGRPSPGFRVELLDPVSGAPGATEGEIALDLAARPVGLMTGYHGDPDRTAEAMAGGY
YRTGDIATRDEEGYLTYIGRSDDVFKASDYKVSPFELESALLEHEAVAEAAVVPAPDELR
LAVPKAYVVLAEGWEPGPDTAKVIFEHSRDVLAPYKRIRRLEFGALPKTVSGKIRRIELR
EATAAGSESEYREEDFR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcgacggagatgttccgcagggcccgggacttcctgctggaacaccgtgag
gactacgccaccgcctacgagggcttccgctggccccggcccgagcacttcaactgggcg
ctggactggttcgacgagatcgccgacggcaacgaccgcaccgcgctgcacatcgtcgag
gaggacggcagcgagacccggctctccttcgcggagctgtccgagcggtccgaccgggtg
gcccggtggctgcgcgagcgcggggtcgccgccgaggaccgcgtcctcgtcatgctcggc
aaccaggccgagctgtgggagaccgcgctggccgcgatgaagctgcgcgcggtcgtcatc
ccggccaccccgctgctcggcccggccgacctcgccgaccgggtggagcgggggcgagtg
aaacacgtcgtcgtccgggcggaggacaccgccaagttcgccgacgtgcccggcgcctac
acccggatctccgtcggcggcctgccgcaggagggctgggagccgtacgaggacgcctac
gcggtccccgccgagttcgtcccggacggcccgacgctggccgacgacccgctgatgctc
tacttcacctccgggacgaccgcccgccccaagctggtcgagcacacccacacctcgtac
ccggtcgggcacctggccaccatgtactggatcggtctcaagcccggcgacgtccacctg
aacatctcctcgcccggctgggccaagcacgcctggtccaacctcttcgcgccgtggaac
gcggaggcgaccgtcttcgtcttcaactacacccgcttcgacgcggcccggctgatggcc
gagatggaccgggccggcgtgaccacgttctgcgcgccgccgaccgtgtggcggatgctc
atccaggccgacctcgggcagctgcgcaccccgccccgcgagatcgtggccgccggcgag
ccgctcaaccccgaggtcatcgagcaggtccggcgcgcctggggggtggccgtccgggac
ggcttcgggcagaccgagacggccgtgcaggtctccaacagccccggccagccgctgaag
accggctccatgggccgtcccagccccggcttccgggtggaactcctggacccggtctcc
ggcgcgcccggcgcgaccgagggcgagatcgcgctcgacctcgccgcgcgcccggtcggc
ctgatgaccggctaccacggcgacccggaccgcacggcggaggccatggcgggcggctac
taccgcaccggggacatcgccaccagggacgaggaggggtacctcacctacatcgggcgc
agcgacgacgtcttcaaggcctcggactacaaggtgagtccgttcgagctggagagcgcc
ctgctggagcacgaggcggtggccgaggcggcagtcgtgcccgccccggacgagctgcgg
ctcgcggtgcccaaggcgtacgtcgtcctcgccgagggctgggagcccggcccggacacc
gcgaaggtcatcttcgagcactcccgtgacgtgctcgcgccgtacaagcgcatccgccgg
ctggagttcggcgcgctgcccaagaccgtctccggcaagatccgccggatcgaactgcgc
gaggccaccgcggccggctcggagagcgagtaccgcgaggaggacttccggtga

DBGET integrated database retrieval system