KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7271Help
Entry
SHJG_7271         CDS       T02063                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:shy00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8296596..8297519
Genome map
AA seq 307 aa AA seqDB search
MPTILGQNQYGKAENRVVKITRDGATHHIKDLNVSVALSGDMDEVHYSGSNANVLPTDTT
KNTVYAFAKEYGIESAEQFGIHLARHFVTSQEPIHRARIRIEEYAWERIETSDANSRFIG
ADEVKHSFVRRGQETRLTQITYDGERWEVISGLKDLVVMNSTNSEFWGYVKDKYTTLQEA
YDRILATEVSGRWRFNWTDDEQKMPHWEKSYEQTKKHMLQAFAETYSLSLQQTLYQMGAR
IINNRGEIDEVRFSLPNKHHFLVDLEPFGLKNDNEVYFAADRPYGLIEATILRDGCEARI
PVDMTNL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgatcctgggacagaaccagtacggcaaggccgagaaccgagtcgtcaagatc
acgcgggacggcgccacccaccacatcaaggacctcaacgtctccgtcgcactgagcggc
gacatggacgaggtccactactccggctccaacgccaacgtcctgccgaccgacaccacc
aagaacacggtgtacgcgttcgccaaggagtacggcatcgagtccgccgagcagttcggc
atccacctcgcccggcacttcgtcaccagccaggagccgatccaccgcgcccggatccgg
atcgaggagtacgcctgggagcggatcgagacctccgacgccaactcccggttcatcggc
gccgacgaggtcaagcactccttcgtccgcaggggccaggagacccgcctcacccagatc
acctacgacggcgagcggtgggaggtcatctccggcctgaaggacctggtcgtgatgaac
tcgaccaactccgagttctggggctacgtcaaggacaagtacaccaccctccaggaggcg
tacgaccgcatcctggccaccgaggtctccggccgctggcggttcaactggaccgacgac
gagcagaagatgccccactgggagaagtcctacgagcagacgaagaagcacatgctccag
gccttcgccgagacgtactccctctccctccagcagacgctgtaccagatgggcgcgcgc
atcatcaacaaccgcggcgagatcgacgaggtccgcttctcgctgccgaacaagcaccac
ttcctggtggacctggagccgttcggactgaagaacgacaacgaggtctacttcgccgcc
gaccgcccctacggcctcatcgaggccaccatcctgcgggacggctgtgaggcccgtatc
ccggtcgacatgaccaacctctga

DBGET integrated database retrieval system