KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7291Help
Entry
SHJG_7291         CDS       T02063                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_7291
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SHJG_7291
   00630 Glyoxylate and dicarboxylate metabolism
    SHJG_7291
Enzymes [BR:shy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SHJG_7291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8319406..8321031)
Genome map
AA seq 541 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQEEVLTDAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWKVAPAPAALNDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVLGQLNLIDAYTRNIDFTDERTGKSYALRPNEELATVVMRPRGWHLDERHL
ADAGGRAVPGALVDFGLYFFHNARRLLDLGKGPYFYLPKTESHLEARLWNDVFVFAQDHL
GVPQGTIRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGPKFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDAEVNKVAFEKVRADKD
REANDGFDGSWVAHPDLVPIAMESFDKVLGDKPNQKDRLREDVRVEAADLIAIDSLDAKP
TYAGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVEFENGEK
ATPELARKVAAEELDAIRAEIGEAAFAAGHWQEAHDLLLRVALDEDYADFLTLPAYRQLR
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgacgccgagcccctgccccggcag
gaggaggtcctcacggacgcggcgctcgccttcgtggcggagctgcaccggcggttcacc
ccgcgccgtgacgaactcctggcccgccgggccgagcgccgcgccgagatcgcccgcacc
tccacgctcgacttcctgccggagacggccgcgatccgcgcggacgactcctggaaggtc
gccccggccccggccgcgctgaacgaccggcgcgtcgagatcaccggccccaccgaccgc
aagatgaccatcaacgcgctcaactcgggcgcgagggtctggctcgccgacttcgaggac
gcctccgcccccacctgggagaacgtggtcctcggccagctcaacctgatcgacgcctac
acccggaacatcgacttcaccgacgagcgcaccggcaagtcgtacgccctgcggccgaac
gaggagctggcgaccgtcgtcatgcgcccgcgcggctggcacctggacgaacggcacctg
gccgacgccggcggccgggccgtccccggcgccctcgtcgacttcggcctgtacttcttc
cacaacgcgcggcggctgctcgacctcggcaagggcccgtacttctacctgccgaagacc
gagtcgcacctcgaagcccgcctgtggaacgacgtgttcgtcttcgcgcaggaccacctc
ggcgtcccgcagggcaccatccgcgccaccgtcctgatcgagaccatcacggccgcgtac
gagatggaggagatcctctacgaactgcgcgaccacgcctccgggctgaacgccggccgc
tgggactacctgttctccatcgtgaagaacttccgtgacggcgggccgaagttcgtgctc
ccggaccgcaacgcggtcaccatgaccgccccgttcatgcgggcgtacaccgaactcctc
gtccgcacctgccacaagcgcggcgcgcacgccatcggcggcatggcggccttcatcccg
tcccgcaaggacgccgaggtcaacaaggtcgccttcgagaaggtccgcgccgacaaggac
cgcgaggcgaacgacggcttcgacggctcctgggtcgcccaccccgacctggtcccgatc
gccatggagtccttcgacaaggtcctcggcgacaagcccaaccagaaggaccgcctccgc
gaggacgtgcgcgtcgaggccgccgacctcatcgcgatcgactccctcgacgccaagccg
acgtacgccggtctcgtcaacgccgtccaggtcggcatccggtacatcgaggcctggctg
cgcgggctcggcgcggtcgccatcttcaacctcatggaggacgcggccaccgccgagatc
tcccgctcgcagatctggcagtggatcaacgccggggtcgagttcgagaacggcgagaag
gccacgccggagctggcccgcaaggtcgccgccgaggaactcgacgccatccgcgcggag
atcggcgaggcggccttcgccgccgggcactggcaggaggcgcacgacctgctgctgcgg
gtggccctcgacgaggactacgccgacttcctcaccctgccggcgtaccggcagctgcgc
ggctga

DBGET integrated database retrieval system