KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7291Help
Entry
SHJG_7291         CDS       T02063                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_7291
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SHJG_7291
   00630 Glyoxylate and dicarboxylate metabolism
    SHJG_7291
Enzymes [BR:shy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SHJG_7291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8319406..8321031)
Genome map
AA seq 541 aa AA seqDB search
MSAPAPSPLAIVDAEPLPRQEEVLTDAALAFVAELHRRFTPRRDELLARRAERRAEIART
STLDFLPETAAIRADDSWKVAPAPAALNDRRVEITGPTDRKMTINALNSGARVWLADFED
ASAPTWENVVLGQLNLIDAYTRNIDFTDERTGKSYALRPNEELATVVMRPRGWHLDERHL
ADAGGRAVPGALVDFGLYFFHNARRLLDLGKGPYFYLPKTESHLEARLWNDVFVFAQDHL
GVPQGTIRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDGGPKFVL
PDRNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRKDAEVNKVAFEKVRADKD
REANDGFDGSWVAHPDLVPIAMESFDKVLGDKPNQKDRLREDVRVEAADLIAIDSLDAKP
TYAGLVNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVEFENGEK
ATPELARKVAAEELDAIRAEIGEAAFAAGHWQEAHDLLLRVALDEDYADFLTLPAYRQLR
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcgccgtccccgctggccatcgtcgacgccgagcccctgccccggcag
gaggaggtcctcacggacgcggcgctcgccttcgtggcggagctgcaccggcggttcacc
ccgcgccgtgacgaactcctggcccgccgggccgagcgccgcgccgagatcgcccgcacc
tccacgctcgacttcctgccggagacggccgcgatccgcgcggacgactcctggaaggtc
gccccggccccggccgcgctgaacgaccggcgcgtcgagatcaccggccccaccgaccgc
aagatgaccatcaacgcgctcaactcgggcgcgagggtctggctcgccgacttcgaggac
gcctccgcccccacctgggagaacgtggtcctcggccagctcaacctgatcgacgcctac
acccggaacatcgacttcaccgacgagcgcaccggcaagtcgtacgccctgcggccgaac
gaggagctggcgaccgtcgtcatgcgcccgcgcggctggcacctggacgaacggcacctg
gccgacgccggcggccgggccgtccccggcgccctcgtcgacttcggcctgtacttcttc
cacaacgcgcggcggctgctcgacctcggcaagggcccgtacttctacctgccgaagacc
gagtcgcacctcgaagcccgcctgtggaacgacgtgttcgtcttcgcgcaggaccacctc
ggcgtcccgcagggcaccatccgcgccaccgtcctgatcgagaccatcacggccgcgtac
gagatggaggagatcctctacgaactgcgcgaccacgcctccgggctgaacgccggccgc
tgggactacctgttctccatcgtgaagaacttccgtgacggcgggccgaagttcgtgctc
ccggaccgcaacgcggtcaccatgaccgccccgttcatgcgggcgtacaccgaactcctc
gtccgcacctgccacaagcgcggcgcgcacgccatcggcggcatggcggccttcatcccg
tcccgcaaggacgccgaggtcaacaaggtcgccttcgagaaggtccgcgccgacaaggac
cgcgaggcgaacgacggcttcgacggctcctgggtcgcccaccccgacctggtcccgatc
gccatggagtccttcgacaaggtcctcggcgacaagcccaaccagaaggaccgcctccgc
gaggacgtgcgcgtcgaggccgccgacctcatcgcgatcgactccctcgacgccaagccg
acgtacgccggtctcgtcaacgccgtccaggtcggcatccggtacatcgaggcctggctg
cgcgggctcggcgcggtcgccatcttcaacctcatggaggacgcggccaccgccgagatc
tcccgctcgcagatctggcagtggatcaacgccggggtcgagttcgagaacggcgagaag
gccacgccggagctggcccgcaaggtcgccgccgaggaactcgacgccatccgcgcggag
atcggcgaggcggccttcgccgccgggcactggcaggaggcgcacgacctgctgctgcgg
gtggccctcgacgaggactacgccgacttcctcaccctgccggcgtaccggcagctgcgc
ggctga

DBGET integrated database retrieval system