KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7333Help
Entry
SHJG_7333         CDS       T02063                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:shy00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shy00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shy00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shy00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8363255..8364166
Genome map
AA seq 303 aa AA seqDB search
MTPVPPVPLRKAVIPAAGMGTRFLPATKATPKEMLPVVDKPAIQYVVEEAVAAGLTDVLM
VTGRNKRALEDHFDRNQELERLLRAKGDHGRLEKVRATNDLAALHYVRQGEPKGLGHAVL
CAAPHVGDEPFAVLLGDDLIDPRDPLLARMAEVQGEHGGSVIALMEVDPAQIHLYGCAAV
DLTKDADVVQVTSLVEKPQPGTAPSDLAVIGRYVLSPAVFDVLRDTPPGRGGEIQLTDAL
QRLLSDGDEQIHAVVFKGRRYDTGDRGDYLRAIVRLACEREDLGEEFRTWLHRYVTESMP
KSP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgtaccgcccgtccccttgcggaaggccgtcatccccgcggcaggcatggga
acgcggttcctgcccgccacgaaggccacgcccaaggagatgctgcccgtcgtcgacaag
ccggccatccagtacgtcgtcgaggaggccgtggccgccggactgaccgacgtcctcatg
gtcaccggacgcaacaagagagcgctggaggaccacttcgaccgcaaccaggagctggaa
cgcctcctgcgggccaagggcgaccacggccggctggagaaggtgcgggccaccaacgac
ctcgccgccctgcactacgtgcgacagggggagcccaaggggctcggccacgccgtcctg
tgcgccgccccgcacgtgggggacgaacccttcgccgtactgctcggggacgacctcatc
gacccgcgcgaccccctgctcgcccggatggccgaggtccagggcgagcacggcggcagc
gtcatcgcgctgatggaggtcgaccccgcgcagatccacctctacggctgtgccgcggtc
gacctcaccaaggacgccgacgtcgtccaggtgacctccctcgtggagaagccgcagccc
ggcacggcgcccagtgacctcgccgtcatcggccggtacgtgctctccccggccgtcttc
gacgtcctgcgcgacaccccgcccggcaggggaggggagatccagctcaccgacgcgctg
caacggctgctgtccgacggggacgagcagatccacgccgtcgtcttcaagggccgccgc
tacgacaccggtgaccgcggggactacctgcgcgccatcgtgcggctcgcgtgcgaacgc
gaggacctcggcgaggagttccgcacctggctccaccggtacgtcaccgagtcgatgccg
aagagcccctga

DBGET integrated database retrieval system