KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_7626Help
Entry
SHJG_7626         CDS       T02063                                 

Definition
fatty acid oxidative multifunctional enzyme
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SHJG_7626
   01212 Fatty acid metabolism
    SHJG_7626
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SHJG_7626
   00650 Butanoate metabolism
    SHJG_7626
  Lipid metabolism
   00071 Fatty acid degradation
    SHJG_7626
   01040 Biosynthesis of unsaturated fatty acids
    SHJG_7626
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SHJG_7626
   00310 Lysine degradation
    SHJG_7626
   00380 Tryptophan metabolism
    SHJG_7626
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJG_7626
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SHJG_7626
   00281 Geraniol degradation
    SHJG_7626
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SHJG_7626
Enzymes [BR:shy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SHJG_7626
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SHJG_7626
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SHJG_7626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8679634..8681811
Genome map
AA seq 725 aa AA seqDB search
MTESTTIRWEQDDTGVVTLVLDDPNQSANTMNQAFRDSLAVITDRLEAERDNIRGIILTS
AKKTFFAGGDLRDLIRVTPETAQELFDGGLAIKRDLRRIETLGKPVVAAINGAALGGGYE
LALACHHRVALDTPGTRIGCPEVTLGLLPGGGGVVRTVRLLGIADALLKVLLQGRQYNAR
RAQENGLVHEVAATPEELLAKARAFIDANPESRQPWDTPGYRIPGGTPANPKFAANLPAF
PANLRKQTGGAPYPAPRNILAAAVEGSQVDFETAQVIEARYFVELAAGQTSKNMIQAFFF
DLQAVNSGANRPQGVEPRQVRRVAVLGAGMMGAGIAYACARAGIDVVLKDVSLEAALKGK
GYSEQLCAKAVAKGRTSQEKADALLARITPTAEVADLAGCDAVIEAVFEDTALKHKVFQE
IEAVVAPDALLCSNTSTLPITTLAEGVQRQSDFIGLHFFSPVDKMPLVEIIKGERTGEET
LARAFDLVRQINKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGIEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRGETKRAVEEAGGTWTAHPAEAVVDRMVDEFGRTGRSGGAGF
YDYTEDGKRAGLWPGLREHFTRPGYEIPFRDMQERMLFAEALDTVRLLEEGVLTSVADAN
IGSILGIGFPGWTGGVLQYINGYEGGLPGFVARARELAERYGERFAPPALLVAKAGNGET
FTDAR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccaccatccgctgggagcaggacgacaccggtgtcgtcaccctcgtc
ctggacgacccgaaccagtccgcgaacaccatgaaccaggcgttccgcgactccctcgcc
gtgatcaccgaccggctggaggcggagcgggacaacatccgcggcatcatcctcacctcc
gcgaagaagaccttcttcgcgggcggcgacctgcgcgacctgatccgggtcacgcccgag
accgcgcaggagctgttcgacggcggcctcgccatcaagcgcgacctgcgccgcatcgag
accctcggcaagccggtcgtcgccgccatcaacggcgcggccctcggcggcgggtacgaa
ctggccctggcctgccaccaccgggtcgccctggacacccccggcaccaggatcggctgt
cccgaggtcaccctcggcctgctccccggcggcggcggagtcgtgcgtaccgtgcggctg
ctgggcatcgcggacgccctgctgaaggtgctcctccagggccggcagtacaacgcgcgg
cgcgcccaggagaacggcctcgtccacgaggtcgccgccacccccgaggaactgctcgcc
aaggcccgggccttcatcgacgcgaaccccgagtcccggcagccctgggacacgccgggc
taccggatccccggcggcaccccggccaacccgaagttcgccgccaacctgcccgccttc
ccggccaacctgcgcaagcagacgggcggcgccccctacccggcgccgcgcaacatcctc
gccgccgccgtcgagggctcccaggtcgacttcgagaccgcccaggtcatcgaggcccgc
tacttcgtggaactggccgccgggcagacctcgaagaacatgatccaggcgttcttcttc
gacctccaggcggtcaactccggcgccaaccgcccccagggtgtcgagccccgccaggtc
cgcagggtggccgtcctgggcgccggcatgatgggcgccggcatcgcctacgcgtgcgcc
cgcgcgggcatcgacgtcgtcctcaaggacgtctccctggaagcggccctcaagggcaag
ggctactccgagcagctgtgcgccaaggccgtcgccaagggccgcaccagccaggagaag
gcggacgcgctgctcgcccggatcacccccaccgccgaggtggccgacctcgccggctgc
gacgcggtcatcgaggccgtgttcgaggacaccgccctcaagcacaaggtgttccaggag
atcgaggccgtcgtcgcccccgacgcgctgctgtgctccaacacctccacgctgcccatc
accaccctcgccgagggcgtgcagcgccagagcgacttcatcgggctgcacttcttctcg
ccggtcgacaagatgccgctggtcgagatcatcaagggcgagcgcaccggcgaggagacc
ctcgcccgcgccttcgacctggtccggcagatcaacaagacgccgatcgtcgtcaacgac
tcccgcggcttcttcacctcccgggtgatcggccatttcatcaacgagggcgtcgccatg
gtgggcgagggcatcgagcccgcctccgtggagcaggccgccgcccaggccggctacccg
gccaaggtgctgtccctcatggacgagctgaccctcaccctcccgcgcaagatccggggc
gagaccaagcgggccgtggaggaggccggcggcacctggacggcgcacccggcggaggcg
gtcgtcgaccgcatggtcgacgagttcggccgcaccggccgcagcggcggcgccggcttc
tacgactacaccgaggacggcaagcgggccgggctctggccgggcctgcgcgagcacttc
accaggcccgggtacgagatcccgttccgggacatgcaggagcgcatgctcttcgccgag
gcgctcgacaccgtacgcctcctcgaagagggcgtcctgacctccgtcgccgacgccaac
atcggctcgatcctcggcatcggcttccccggctggaccggcggtgtgctccagtacatc
aacggttacgaagggggcctgcccggattcgtggcccgcgcgcgggagctggccgagcgg
tacggcgagcggttcgccccgccggcgctgctcgtggcgaaggccgggaacggggagacg
ttcaccgacgcccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system