KEGG   Streptomyces hygroscopicus subsp. jinggangensis 5008: SHJG_8009Help
Entry
SHJG_8009         CDS       T02063                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
shy  Streptomyces hygroscopicus subsp. jinggangensis 5008
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:shy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SHJG_8009
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SHJG_8009
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SHJG_8009
Enzymes [BR:shy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SHJG_8009
Exosome [BR:shy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SHJG_8009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9155463..9156683)
Genome map
AA seq 406 aa AA seqDB search
MVLNPTPGASASAPQSTVKAKAPTAKNVIFINGDGMGAAAREAARLHLAGLQGQLTMDRL
PVSGQLTTTPDDPKAVVTDSAAAATAWATGEKTYNGAISVDTDGNPLPTLGAQAKAAGKS
TGLVTTAQVTDASPAAFFANTADRGKQDEIARQYLDVSKPDVILGGGEDWWLPAGTAGAF
PDKPAEDTSEGSRGTKGNLIAKAKRSGYQYVTSAKDLNKAPAGKLLGLFGNEEMFQQRPE
GQGDVYSPAVDLATMTSKALKTLDKNKKGFFLMVEEEGVDEFAHNDNGTRVLQSMQQLEK
AVAVARAYQATHPDTLLVVTGDHETGGLAVEENDTADESGSGVSVEDGPFTIHGSDRTFT
IDWTTSGHTSVDVPVTAAGPLASRFTGKHANTYVHDVLSQVLAPRH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcaaccccacgccgggcgcgtccgccagtgctccgcagagcacggtgaaggcg
aaggcccccaccgcgaagaacgtcatcttcatcaacggcgacggcatgggtgccgccgcg
cgtgaggcggcacgactgcacctcgcgggcctccagggccagctgacgatggaccggctt
cccgtgtccggtcagctgacgaccacgccggacgaccccaaggccgtggtcacggactcc
gcggcggctgccaccgcatgggccacgggcgagaagacgtacaacggcgcgatcagcgtc
gacactgacggcaacccgctccccacgctcggggcgcaggccaaggcggcgggcaagtcc
accggcctggtgaccaccgcacaggtcaccgacgcctcacccgcggccttcttcgccaac
accgccgaccgcggcaagcaggacgagatcgcccgccagtacctcgacgtcagcaagccg
gacgtcatcctgggcggtggcgaggactggtggctgccggccggcaccgcgggtgccttc
cccgacaagcccgccgaggacaccagcgagggcagccgcggcacgaagggcaacctgatc
gccaaggccaagcgctccggctaccagtacgtcaccagcgcgaaggacctgaacaaggcc
cccgccggcaagttgctcggtctcttcggcaacgaggagatgttccagcagcgccccgag
ggccagggcgacgtgtacagcccggcggtcgacctcgccacgatgaccagcaaggcactg
aagacgctggacaagaacaagaagggcttcttcctcatggtcgaggaggaaggcgtggac
gagttcgcgcacaacgacaacggcacgcgggtcctgcaatcgatgcagcaactggagaag
gccgtcgccgtcgcccgcgcctaccaggcgacccacccggacaccctcctcgttgtcacc
ggcgaccacgagaccggcggcctggcggtcgaggagaacgacaccgcggacgagtccggc
agtggcgtctccgtcgaggacggcccgttcacgatccacggcagtgaccggacgttcacg
atcgactggacgacgtccggccacaccagtgtcgacgtgcccgtcacggccgccggcccg
cttgcgagccggttcaccggcaagcacgccaacacctacgtccacgacgtcctgtcccag
gtcctggccccccgccactga

DBGET integrated database retrieval system